Clone RT07312 Report

Search the DGRC for RT07312

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:73
Well:12
Vector:pCR2.1
Associated Gene/TranscriptCG34052-RA
Protein status:RT07312.pep: wuzgold
Sequenced Size:346

Clone Sequence Records

RT07312.complete Sequence

346 bp assembled on 2010-04-27

GenBank Submission: BT124842.1

> RT07312.complete
ATGGGAGTTGCTACCAAAATCTTTCGTTCGCACGTTCAAGGCAGCAAAAA
AGCAAAAGCAACAGCCACATCAAGAAGCGCAACAAGAAGGCCAAGAACAG
TACGGTACAGTAAGGACTGCCTGTGCGGAATGTTGTGTAAAAATAAATAC
GCCTAATTGGAACTGCCCTGCAAGCCTCACTGTACTTCAGCCCAAAGGAG
ATGGCGTTTGGCGAGCAGGGAGCAAGTGGAGGAGACCCGGGGAGCTGTAG
ACACCGAAACCGAAACAGTAACATCCTGGCGGAAAAGTACTCACATACAT
ATGTACATGTGTACTTGCGCGACGAGTCTAATACCAATAATCCTTT

RT07312.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG34052-RA 451 CG34052-RA 1..346 1..346 1730 100 Plus
CG34052.b 952 CG34052.b 1..346 1..346 1730 100 Plus
CG34052.a 616 CG34052.a 49..390 1..346 1645 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:19:23
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2215762..2215969 346..141 975 99 Minus
chrX 22417052 chrX 2216034..2216174 140..1 655 99.3 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2321855..2322060 346..141 1030 100 Minus
X 23542271 X 2322125..2322264 140..1 700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2329953..2330158 346..141 1030 100 Minus
X 23527363 X 2330223..2330362 140..1 700 100 Minus
Blast to na_te.dros performed 2019-03-16 15:19:22
Subject Length Description Subject Range Query Range Score Percent Strand
X-element 4740 X-element ROXELEMENT 4740bp 1540..1582 42..82 110 79.1 Plus
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 680..716 312..277 101 78.4 Minus

RT07312.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:20:01 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2215762..2215969 141..346 99 <- Minus
chrX 2216034..2216174 1..140 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-27 10:50:44 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
CG34052-RA 1..156 1..156 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:24:16 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
CG34052-RA 1..156 1..156 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-27 10:50:44 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
CG34052-RA 1..346 1..346 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:24:16 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
CG34052-RA 1..346 1..346 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:01 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
X 2321855..2322060 141..346 100 <- Minus
X 2322125..2322264 1..140 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:01 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
X 2321855..2322060 141..346 100 <- Minus
X 2322125..2322264 1..140 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:20:01 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
X 2321855..2322060 141..346 100 <- Minus
X 2322125..2322264 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:08 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2215888..2216093 141..346 100 <- Minus
arm_X 2216158..2216297 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:08 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2215888..2216093 141..346 100 <- Minus
arm_X 2216158..2216297 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:43:08 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2215888..2216093 141..346 100 <- Minus
arm_X 2216158..2216297 1..140 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:56:17 Download gff for RT07312.complete
Subject Subject Range Query Range Percent Splice Strand
X 2329953..2330158 141..346 100 <- Minus
X 2330223..2330362 1..140 100   Minus

RT07312.pep Sequence

Translation from 0 to 155

> RT07312.pep
MGVATKIFRSHVQGSKKAKATATSRSATRRPRTVRYSKDCLCGMLCKNKY
A*

RT07312.pep Blast Records

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 18:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19482-PA 48 GM19482-PA 1..44 1..44 212 93.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 18:02:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17976-PA 48 GD17976-PA 1..44 1..44 206 88.6 Plus

RT07312.hyp Sequence

Translation from 1 to 249

> RT07312.hyp
WELLPKSFVRTFKAAKKQKQQPHQEAQQEGQEQYGTVRTACAECCVKINT
PNWNCPASLTVLQPKGDGVWRAGSKWRRPGEL*
Sequence RT07312.hyp has no blast hits.