Clone RT07316 Report

Search the DGRC for RT07316

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:73
Well:16
Vector:pCR2.1
Associated Gene/TranscriptCG34185-RA
Protein status:RT07316.pep: gold
Sequenced Size:381

Clone Sequence Records

RT07316.complete Sequence

381 bp assembled on 2010-04-26

GenBank Submission: BT124813.1

> RT07316.complete
ATGAACCAGTTAACCTTTGTATGCTGCCTTTTGTTGTGGTCCGGGTCTCA
GGCTGCGTTCCAGGACTTTGTGATTGGACCTGAATCCTATGAAGGTGGTA
ACGATGTCGTCCCGTTTGGTCAAGAATTATCGGATGAGGTGGATGAGGAT
ATAATGGTGTCATTCCAGGATGTACAGCATGATGGAATAGTGGATACCAA
TCTACTGATGAAAGCTATAATGCAGCATGCCAAACGTTTGGGCATGAGCC
TGGATGAACTTGCTAGCTTAAATGTGCAGTCAGAAGATGAGGAATCTATG
AACCAACTTGGGTGCTCAGCTGAGCAAGACGTCTTCGGATACCCAGAAAA
GCCCACTTGGCGGGACGTACTCTTTAACTGA

RT07316.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG34185-RA 450 CG34185-RA 63..443 1..381 1905 100 Plus
nc_6785.a 387 nc_6785.a 153..387 262..29 1105 98.7 Minus
nc_6785.a 387 nc_6785.a 1..94 355..262 470 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10261318..10261495 262..85 890 100 Minus
chr2R 21145070 chr2R 10261141..10261259 380..262 595 100 Minus
chr2R 21145070 chr2R 10261554..10261637 84..1 420 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14374014..14374191 262..85 890 100 Minus
2R 25286936 2R 14373836..14373955 381..262 600 100 Minus
2R 25286936 2R 14374250..14374333 84..1 420 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14375213..14375390 262..85 890 100 Minus
2R 25260384 2R 14375035..14375154 381..262 600 100 Minus
2R 25260384 2R 14375449..14375532 84..1 420 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:26:06 has no hits.

RT07316.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:27:05 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10261318..10261495 85..262 100 <- Minus
chr2R 10261554..10261637 1..84 100   Minus
chr2R 10261141..10261258 263..380 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 17:01:43 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 1..380 1..380 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:31:05 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 1..380 1..380 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:41:47 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 1..381 1..381 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:07:55 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 1..381 1..381 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 17:01:43 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 1..380 1..380 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:31:05 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 1..380 1..380 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:41:47 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 63..442 1..380 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:07:55 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
CG34185-RA 63..442 1..380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:05 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14373837..14373954 263..380 100 <- Minus
2R 14374014..14374191 85..262 100 <- Minus
2R 14374250..14374333 1..84 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:05 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14373837..14373954 263..380 100 <- Minus
2R 14374014..14374191 85..262 100 <- Minus
2R 14374250..14374333 1..84 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:05 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14373837..14373954 263..380 100 <- Minus
2R 14374014..14374191 85..262 100 <- Minus
2R 14374250..14374333 1..84 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:41:47 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10261342..10261459 263..380 100 <- Minus
arm_2R 10261519..10261696 85..262 100 <- Minus
arm_2R 10261755..10261838 1..84 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:02 Download gff for RT07316.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14375036..14375153 263..380 100 <- Minus
2R 14375213..14375390 85..262 100 <- Minus
2R 14375449..14375532 1..84 100   Minus

RT07316.pep Sequence

Translation from 0 to 380

> RT07316.pep
MNQLTFVCCLLLWSGSQAAFQDFVIGPESYEGGNDVVPFGQELSDEVDED
IMVSFQDVQHDGIVDTNLLMKAIMQHAKRLGMSLDELASLNVQSEDEESM
NQLGCSAEQDVFGYPEKPTWRDVLFN*

RT07316.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11353-PA 127 GF11353-PA 1..127 1..126 374 57.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22426-PA 126 GG22426-PA 1..126 1..126 576 84.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22121-PA 135 GH22121-PA 3..135 2..126 182 37.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG34185-PA 126 CG34185-PA 1..126 1..126 662 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11402-PA 168 GL11402-PA 31..168 1..126 339 52.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:35:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24710-PA 168 GA24710-PA 31..168 1..126 341 52.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20214-PA 126 GM20214-PA 1..126 1..126 609 91.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25685-PA 90 GD25685-PA 1..88 1..88 417 89.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20333-PA 128 GJ20333-PA 1..128 1..126 230 42.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:35:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12316-PA 94 GE12316-PA 1..88 1..88 380 80.7 Plus

RT07316.hyp Sequence

Translation from 1 to 378

> RT07316.hyp
MNQLTFVCCLLLWSGSQAAFQDFVIGPESYEGGNDVVPFGQELSDEVDED
IMVSFQDVQHDGIVDTNLLMKAIMQHAKRLGMSLDELASLNVQSEDEESM
NQLGCSAEQDVFGYPEKPTWRDVLFN

RT07316.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG34185-PA 126 CG34185-PA 1..126 1..126 662 100 Plus