Clone RT07324 Report

Search the DGRC for RT07324

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:73
Well:24
Vector:pCR2.1
Associated Gene/TranscriptCG32318-RA
Protein status:RT07324.pep: gold
Sequenced Size:495

Clone Sequence Records

RT07324.complete Sequence

495 bp assembled on 2010-04-23

GenBank Submission: BT124785.1

> RT07324.complete
ATGGACATATCTGGTGGGAATACGTCGCGCCAGCCCCAAAAGAAGTCCAA
CCAAAACATCCAGGTGTATGTGCGCGTCAGACCCCTTAATTCTCGGGAAC
GTTGCATCCGCTCGGCCGAAGTCGTGGATGTGGTCGGACCACGGGAAGTG
GTCACCCGCCACACGCTGGACTCCAAGCTCACCAAGAAGTTCACCTTTGA
CCGCAGTTTTGGCCCCGAGTCCAAGCAGTGCGATGTCTACTCCGTCGTGG
TGTCTCCGCTGATCGAGGAGGTCCTCAATGGCTATAACTGCACGGTGTTT
GCTTATGGCCAGACGGGCAACAATCTGCGTCCGCCCAAGTCACTTTACAT
CGAGGTGCGCTGCATGGAGGACTATGGGAAGTTCGAGCTGGACGACGGCG
AGGTGATCCACCTGAAGAAGAACAGCCAGCACTATCTGCCCCGAGCTCAG
GTGGAGTCTCTCGTGAGGCAGGGCATTCTTCACCACATAGCCTAG

RT07324.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG32318-RA 495 CG32318-RA 1..495 1..495 2475 100 Plus
Klp61F.a 3896 Klp61F.a 296..614 1..319 1595 100 Plus
Klp61F-RA 3900 Klp61F-RA 300..618 1..319 1595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1245588..1246004 495..79 2085 100 Minus
chr3L 24539361 chr3L 1244771..1245011 319..79 1190 99.6 Minus
chr3L 24539361 chr3L 1246581..1246758 495..318 890 100 Minus
chr3L 24539361 chr3L 1245076..1245155 80..1 400 100 Minus
chr3L 24539361 chr3L 1246069..1246148 80..1 400 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1246073..1246489 495..79 2085 100 Minus
3L 28110227 3L 1245256..1245496 319..79 1205 100 Minus
3L 28110227 3L 1247066..1247243 495..318 890 100 Minus
3L 28110227 3L 1246554..1246633 80..1 400 100 Minus
3L 28110227 3L 1245561..1245640 80..1 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1246073..1246489 495..79 2085 100 Minus
3L 28103327 3L 1245256..1245496 319..79 1205 100 Minus
3L 28103327 3L 1247066..1247243 495..318 890 100 Minus
3L 28103327 3L 1246554..1246633 80..1 400 100 Minus
3L 28103327 3L 1245561..1245640 80..1 400 100 Minus
Blast to na_te.dros performed on 2019-03-16 17:29:47 has no hits.

RT07324.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:30:27 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1245588..1246002 81..495 100 <- Minus
chr3L 1246069..1246148 1..80 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-23 14:22:10 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 1..495 1..495 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:26:49 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 1..495 1..495 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:31 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 1..495 1..495 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:00:28 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 1..495 1..495 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-23 14:22:10 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 1..495 1..495 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:26:49 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 257..751 1..495 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:31 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 291..785 1..495 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:00:28 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
CG32318-RA 291..785 1..495 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:30:27 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246073..1246487 81..495 100 <- Minus
3L 1246554..1246633 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:30:27 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246073..1246487 81..495 100 <- Minus
3L 1246554..1246633 1..80 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:30:27 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246073..1246487 81..495 100 <- Minus
3L 1246554..1246633 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:31 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1246073..1246487 81..495 100 <- Minus
arm_3L 1246554..1246633 1..80 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:19 Download gff for RT07324.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1246073..1246487 81..495 100 <- Minus
3L 1246554..1246633 1..80 100   Minus

RT07324.pep Sequence

Translation from 0 to 494

> RT07324.pep
MDISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREV
VTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVF
AYGQTGNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQ
VESLVRQGILHHIA*

RT07324.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:28:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10068-PA 1065 GF10068-PA 1..106 1..106 541 92.5 Plus
Dana\GF25042-PA 204 GF25042-PA 99..204 70..164 312 63 Plus
Dana\GF15784-PA 1026 GF15784-PA 13..95 20..107 175 44.4 Plus
Dana\GF25291-PA 784 GF25291-PA 17..109 17..106 172 41.9 Plus
Dana\GF23742-PA 805 GF23742-PA 8..115 19..106 167 42.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14613-PA 1066 GG14613-PA 1..106 1..106 570 97.2 Plus
Dere\GG14612-PA 202 GG14612-PA 126..202 92..164 309 79.5 Plus
Dere\GG15531-PA 784 GG15531-PA 17..109 17..106 182 43 Plus
Dere\GG10128-PA 1048 GG10128-PA 14..96 20..107 163 42.2 Plus
Dere\GG16409-PA 645 GG16409-PA 3..91 18..106 153 37.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:28:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16010-PA 1069 GH16010-PA 1..110 1..106 486 82.7 Plus
Dgri\GH15736-PA 200 GH15736-PA 99..200 70..164 292 57.7 Plus
Dgri\GH15084-PA 796 GH15084-PA 17..109 17..106 177 43 Plus
Dgri\GH13544-PA 1050 GH13544-PA 14..96 20..107 166 44.3 Plus
Dgri\GH23984-PA 648 GH23984-PA 3..91 18..106 148 37.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG32318-PA 164 CG32318-PA 1..164 1..164 857 100 Plus
Klp61F-PA 1066 CG9191-PA 1..106 1..106 549 100 Plus
Psf1-PA 202 CG9187-PA 145..202 107..164 308 100 Plus
Klp68D-PB 784 CG7293-PB 5..109 9..106 181 41.9 Plus
Klp68D-PA 784 CG7293-PA 5..109 9..106 181 41.9 Plus
Klp31E-PE 1047 CG5300-PE 11..96 17..107 159 41.9 Plus
Klp31E-PC 1048 CG5300-PC 11..96 17..107 159 41.9 Plus
Klp31E-PB 1048 CG5300-PB 11..96 17..107 159 41.9 Plus
Klp31E-PA 1048 CG5300-PA 11..96 17..107 159 41.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12274-PA 1069 GI12274-PA 1..133 1..135 507 72.3 Plus
Dmoj\GI12793-PA 200 GI12793-PA 99..199 70..163 284 60.6 Plus
Dmoj\GI13731-PA 782 GI13731-PA 17..109 17..106 169 41.9 Plus
Dmoj\GI10628-PA 1049 GI10628-PA 13..95 20..107 156 44.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:28:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16079-PA 175 GL16079-PA 12..108 10..106 472 88.7 Plus
Dper\GL16122-PA 202 GL16122-PA 106..202 78..164 310 65.3 Plus
Dper\GL20721-PA 699 GL20721-PA 5..109 9..106 177 41 Plus
Dper\GL19006-PA 1057 GL19006-PA 11..96 17..107 147 38.7 Plus
Dper\GL12159-PA 157 GL12159-PA 9..113 8..106 141 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21600-PA 1063 GA21600-PA 12..108 10..106 483 87.6 Plus
Dpse\GA28390-PA 202 GA28390-PA 106..202 78..164 310 65.3 Plus
Dpse\GA20244-PA 797 GA20244-PA 5..109 9..106 177 41 Plus
Dpse\GA10646-PA 801 GA10646-PA 7..113 19..106 143 31.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:28:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14227-PA 1066 GM14227-PA 1..106 1..106 581 99.1 Plus
Dsec\GM14226-PA 196 GM14226-PA 120..196 92..164 318 80.8 Plus
Dsec\GM25299-PA 784 GM25299-PA 17..109 17..106 179 43 Plus
Dsec\GM18350-PA 1046 GM18350-PA 11..96 17..107 163 40.9 Plus
Dsec\GM24884-PA 808 GM24884-PA 8..114 19..106 148 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13489-PA 1036 GD13489-PA 1..106 1..106 582 99.1 Plus
Dsim\GD13488-PA 196 GD13488-PA 120..196 92..164 317 80.8 Plus
Dsim\GD14330-PA 767 GD14330-PA 17..109 17..106 179 43 Plus
Dsim\GD23697-PA 1048 GD23697-PA 11..96 17..107 163 40.9 Plus
Dsim\GD12936-PA 460 GD12936-PA 8..110 19..106 153 39 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13211-PA 1067 GJ13211-PA 1..108 1..106 461 84.3 Plus
Dvir\GJ16092-PA 200 GJ16092-PA 99..200 70..164 289 61 Plus
Dvir\GJ14077-PA 785 GJ14077-PA 17..109 17..106 178 43 Plus
Dvir\GJ21851-PA 1105 GJ21851-PA 14..96 20..107 166 45.5 Plus
Dvir\GJ12203-PA 687 GJ12203-PA 9..110 8..106 148 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11822-PA 1050 GK11822-PA 1..110 1..106 456 77.3 Plus
Dwil\GK16541-PA 191 GK16541-PA 90..191 70..164 303 61.5 Plus
Dwil\GK24537-PA 799 GK24537-PA 9..112 6..106 185 41.3 Plus
Dwil\GK13622-PA 633 GK13622-PA 3..91 18..106 150 37.1 Plus
Dwil\GK16568-PA 777 GK16568-PA 8..114 19..106 150 38.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20974-PA 1066 GE20974-PA 1..106 1..106 571 98.1 Plus
Dyak\GE20973-PA 196 GE20973-PA 120..196 92..164 317 80.8 Plus
Dyak\GE21849-PA 784 GE21849-PA 17..109 17..106 181 43 Plus
Dyak\GE18940-PA 1047 GE18940-PA 13..95 20..107 161 42.2 Plus
Dyak\GE21253-PA 809 GE21253-PA 8..114 19..106 149 38.2 Plus

RT07324.hyp Sequence

Translation from 1 to 494

> RT07324.hyp
MDISGGNTSRQPQKKSNQNIQVYVRVRPLNSRERCIRSAEVVDVVGPREV
VTRHTLDSKLTKKFTFDRSFGPESKQCDVYSVVVSPLIEEVLNGYNCTVF
AYGQTGNNLRPPKSLYIEVRCMEDYGKFELDDGEVIHLKKNSQHYLPRAQ
VESLVRQGILHHIA*

RT07324.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG32318-PA 164 CG32318-PA 1..164 1..164 857 100 Plus
Klp61F-PA 1066 CG9191-PA 1..106 1..106 549 100 Plus
Psf1-PA 202 CG9187-PA 145..202 107..164 308 100 Plus
Klp68D-PB 784 CG7293-PB 5..109 9..106 181 41.9 Plus
Klp68D-PA 784 CG7293-PA 5..109 9..106 181 41.9 Plus