Clone RT07360 Report

Search the DGRC for RT07360

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:73
Well:60
Vector:pCR2.1
Associated Gene/TranscriptCG34430-RA
Protein status:RT07360.pep: gold
Sequenced Size:795

Clone Sequence Records

RT07360.complete Sequence

795 bp assembled on 2010-04-26

GenBank Submission: BT124807.1

> RT07360.complete
ATGGACGCGGTATTGGTAGTGGAAAAATCGGAAGTCCCGGGCATCGCTGT
GCAATGTGACCTCCTTTTGCCCAACGGTCATTTGCAAAGGACCTATGAAT
TCGACATAGCCGATGTTGGAATCCGACGGCGCCTAGTGCGCCGATTCTAC
GGCATATTAATCCTACAGATGGCCTGCACCTTGCCCTGCATTGAGTTGTT
TCTCAAATATCCTTTGCCATACAACTTTGTTATGCCATTATCAATGGTAT
TCACTGTTTTTCTGTATACGTGTTTCTACGTTTGGAGAGATTGGAGGAGA
CATGGGCCTTTCAACTACTTTGTACTGCTGCTGAGCACATTGATTGGATC
CTTCAATAGGAGCGTATATCTACTTAATTTGGTGGAGACACATTGGGTAT
ATATTTATCCAGTCATTCTCATTATTGAAATCTTGGGTCTAATGCTGTAT
TCCTCCCAGAAGCGTTTTCGGTTTACCCAGATTCGCGGAATTTCCATAAT
CAGCCTCATCTTTGGGCTGTTCCTCCTCCTGGCCTACCGACTGAACCGGA
TGATGGAGGTCTTCTCCGCAATGGCCTGCACCGTGGAGGCGTGGTACATA
ATCTACGATACACACTACATGCTGTGCGGCCGACATGGCTACAACATTGG
ACCAGAGGAGTTCGTCTATGCAGCATGCAACATACACTGCGATCTGCCAA
AGGGAATGTGGCGACTGATGAAGATGCTTTTCTTCAGCAAAATTGTCGAG
GCCGTTCGCATGTTCCGTGAATGCTTTAGGACCGAGGTATGCTGA

RT07360.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG34430-RA 795 CG34430-RA 1..795 1..795 3975 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3831469..3831867 396..794 1995 100 Plus
chr2R 21145070 chr2R 3831057..3831293 163..399 1140 98.7 Plus
chr2R 21145070 chr2R 3830835..3830996 1..162 810 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7944076..7944475 396..795 2000 100 Plus
2R 25286936 2R 7943664..7943900 163..399 1185 100 Plus
2R 25286936 2R 7943442..7943603 1..162 810 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7945275..7945674 396..795 2000 100 Plus
2R 25260384 2R 7944863..7945099 163..399 1185 100 Plus
2R 25260384 2R 7944641..7944802 1..162 810 100 Plus
Blast to na_te.dros performed on 2019-03-16 17:32:34 has no hits.

RT07360.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:33:36 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3830835..3830996 1..162 100 -> Plus
chr2R 3831057..3831290 163..396 98 -> Plus
chr2R 3831470..3831867 397..794 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 16:56:16 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:50 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:34:51 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:00:53 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 16:56:16 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:50 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:34:51 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..794 1..794 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:00:53 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
CG34430-RA 1..794 1..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:36 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7943442..7943603 1..162 100 -> Plus
2R 7943664..7943897 163..396 100 -> Plus
2R 7944077..7944474 397..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:36 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7943442..7943603 1..162 100 -> Plus
2R 7943664..7943897 163..396 100 -> Plus
2R 7944077..7944474 397..794 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:33:36 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7943442..7943603 1..162 100 -> Plus
2R 7943664..7943897 163..396 100 -> Plus
2R 7944077..7944474 397..794 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:34:51 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3830947..3831108 1..162 100 -> Plus
arm_2R 3831169..3831402 163..396 100 -> Plus
arm_2R 3831582..3831979 397..794 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:53 Download gff for RT07360.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7944863..7945096 163..396 100 -> Plus
2R 7945276..7945673 397..794 100   Plus
2R 7944641..7944802 1..162 100 -> Plus

RT07360.pep Sequence

Translation from 0 to 794

> RT07360.pep
MDAVLVVEKSEVPGIAVQCDLLLPNGHLQRTYEFDIADVGIRRRLVRRFY
GILILQMACTLPCIELFLKYPLPYNFVMPLSMVFTVFLYTCFYVWRDWRR
HGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGLMLY
SSQKRFRFTQIRGISIISLIFGLFLLLAYRLNRMMEVFSAMACTVEAWYI
IYDTHYMLCGRHGYNIGPEEFVYAACNIHCDLPKGMWRLMKMLFFSKIVE
AVRMFRECFRTEVC*

RT07360.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13646-PA 500 GF13646-PA 55..185 133..263 438 64.9 Plus
Dana\GF18785-PA 255 GF18785-PA 28..239 29..232 218 28.6 Plus
Dana\GF11999-PA 247 GF11999-PA 17..231 24..232 190 27.4 Plus
Dana\GF13646-PA 500 GF13646-PA 1..55 1..55 182 61.8 Plus
Dana\GF11997-PA 323 GF11997-PA 99..307 30..232 176 27.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23315-PA 186 GG23315-PA 55..186 133..264 661 93.9 Plus
Dere\GG23315-PA 186 GG23315-PA 1..55 1..55 252 85.5 Plus
Dere\GG22542-PA 324 GG22542-PA 100..308 30..232 186 29.4 Plus
Dere\GG21447-PA 264 GG21447-PA 46..264 37..247 183 28.1 Plus
Dere\GG22543-PA 244 GG22543-PA 14..228 24..232 179 25.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21303-PA 132 GH21303-PA 1..132 133..264 232 37.1 Plus
Dgri\GH20515-PA 331 GH20515-PA 102..315 24..232 192 27.9 Plus
Dgri\GH20517-PA 246 GH20517-PA 16..230 24..232 185 25.2 Plus
Dgri\GH23740-PA 263 GH23740-PA 47..247 40..232 182 30.2 Plus
Dgri\GH21302-PA 289 GH21302-PA 39..286 2..243 179 24.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG34430-PA 264 CG34430-PA 1..264 1..264 1409 100 Plus
Lfg-PD 239 CG3814-PD 15..223 30..232 198 28.2 Plus
Lfg-PA 239 CG3814-PA 15..223 30..232 198 28.2 Plus
Lfg-PB 244 CG3814-PB 20..228 30..232 198 28.2 Plus
CG9722-PA 264 CG9722-PA 50..249 41..232 189 26.4 Plus
Nmda1-PH 313 CG3798-PH 91..297 34..232 184 27.3 Plus
Nmda1-PG 313 CG3798-PG 91..297 34..232 184 27.3 Plus
Nmda1-PA 313 CG3798-PA 91..297 34..232 184 27.3 Plus
Nmda1-PB 313 CG3798-PB 91..297 34..232 184 27.3 Plus
Nmda1-PI 316 CG3798-PI 94..300 34..232 184 27.3 Plus
Nmda1-PF 316 CG3798-PF 94..300 34..232 184 27.3 Plus
Nmda1-PE 324 CG3798-PE 102..308 34..232 184 27.3 Plus
Nmda1-PC 324 CG3798-PC 102..308 34..232 184 27.3 Plus
Nmda1-PD 324 CG3798-PD 102..308 34..232 184 27.3 Plus
Lfg-PC 203 CG3814-PC 33..187 80..232 167 28.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19792-PA 194 GI19792-PA 55..194 120..264 290 44.8 Plus
Dmoj\GI21061-PA 324 GI21061-PA 95..308 24..232 184 28.8 Plus
Dmoj\GI21062-PA 244 GI21062-PA 19..228 29..232 172 27.1 Plus
Dmoj\GI24550-PA 263 GI24550-PA 48..247 41..232 159 27.3 Plus
Dmoj\GI19790-PA 285 GI19790-PA 69..273 38..234 154 24.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11700-PA 267 GL11700-PA 6..267 4..264 842 60.3 Plus
Dper\GL17450-PA 319 GL17450-PA 95..303 30..232 190 29.4 Plus
Dper\GL17451-PA 245 GL17451-PA 15..229 24..232 172 24.8 Plus
Dper\GL11699-PA 304 GL11699-PA 77..300 26..243 171 24.5 Plus
Dper\GL23305-PA 282 GL23305-PA 42..244 38..232 157 26.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13232-PA 267 GA13232-PA 6..267 4..264 844 60.3 Plus
Dpse\GA17693-PC 308 GA17693-PC 84..292 30..232 191 29.4 Plus
Dpse\GA17693-PB 310 GA17693-PB 86..294 30..232 190 29.4 Plus
Dpse\GA17693-PA 319 GA17693-PA 95..303 30..232 190 29.4 Plus
Dpse\GA17704-PB 237 GA17704-PB 2..221 25..232 174 25.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20993-PA 880 GM20993-PA 55..184 133..262 724 97.7 Plus
Dsec\GM20993-PA 880 GM20993-PA 1..64 1..67 287 82.1 Plus
Dsec\GM20328-PA 244 GM20328-PA 14..228 24..232 184 25.7 Plus
Dsec\GM20327-PA 324 GM20327-PA 100..308 30..232 177 28.1 Plus
Dsec\GM25879-PA 264 GM25879-PA 50..249 41..232 172 27.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10522-PA 880 GD10522-PA 55..184 133..262 723 97.7 Plus
Dsim\GD10522-PA 880 GD10522-PA 1..64 1..67 279 79.1 Plus
Dsim\GD25805-PA 244 GD25805-PA 14..228 24..232 184 25.7 Plus
Dsim\GD25804-PA 324 GD25804-PA 100..308 30..232 174 28.2 Plus
Dsim\GD20449-PA 262 GD20449-PA 48..247 41..232 171 28.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15115-PA 181 GJ15115-PA 50..181 133..264 342 47 Plus
Dvir\GJ21986-PA 244 GJ21986-PA 14..228 24..232 185 27.9 Plus
Dvir\GJ22617-PA 262 GJ22617-PA 38..246 30..232 183 28.9 Plus
Dvir\GJ21985-PA 333 GJ21985-PA 104..317 24..232 181 27.9 Plus
Dvir\GJ15114-PA 302 GJ15114-PA 87..289 38..232 153 25.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21974-PA 185 GK21974-PA 25..185 99..264 420 48.8 Plus
Dwil\GK20879-PA 244 GK20879-PA 14..228 24..232 205 27.4 Plus
Dwil\GK20878-PA 323 GK20878-PA 99..307 30..232 190 29.4 Plus
Dwil\GK21973-PA 299 GK21973-PA 78..285 33..232 185 26.7 Plus
Dwil\GK19213-PA 271 GK19213-PA 39..256 23..232 180 25.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19160-PA 822 GE19160-PA 55..184 133..262 718 96.2 Plus
Dyak\GE19160-PA 822 GE19160-PA 1..64 1..67 278 77.6 Plus
Dyak\GE10054-PA 264 GE10054-PA 50..249 41..232 184 29.6 Plus
Dyak\GE13413-PA 244 GE13413-PA 14..228 24..232 181 26.1 Plus
Dyak\GE13412-PA 324 GE13412-PA 100..308 30..232 174 28.6 Plus

RT07360.hyp Sequence

Translation from 1 to 792

> RT07360.hyp
MDAVLVVEKSEVPGIAVQCDLLLPNGHLQRTYEFDIADVGIRRRLVRRFY
GILILQMACTLPCIELFLKYPLPYNFVMPLSMVFTVFLYTCFYVWRDWRR
HGPFNYFVLLLSTLIGSFNRSVYLLNLVETHWVYIYPVILIIEILGLMLY
SSQKRFRFTQIRGISIISLIFGLFLLLAYRLNRMMEVFSAMACTVEAWYI
IYDTHYMLCGRHGYNIGPEEFVYAACNIHCDLPKGMWRLMKMLFFSKIVE
AVRMFRECFRTEVC

RT07360.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:50:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG34430-PA 264 CG34430-PA 1..264 1..264 1409 100 Plus
CG3814-PD 239 CG3814-PD 15..223 30..232 198 28.2 Plus
CG3814-PA 239 CG3814-PA 15..223 30..232 198 28.2 Plus
CG3814-PB 244 CG3814-PB 20..228 30..232 198 28.2 Plus
CG9722-PA 264 CG9722-PA 50..249 41..232 189 26.4 Plus