Clone RT07511 Report

Search the DGRC for RT07511

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:75
Well:11
Vector:pCR2.1
Associated Gene/TranscriptCG34281-RA
Protein status:RT07511.pep: gold
Sequenced Size:321

Clone Sequence Records

RT07511.complete Sequence

321 bp assembled on 2010-04-26

GenBank Submission: BT124793.1

> RT07511.complete
ATGAAGTACCTTTCATTGTCTTTCCTATTGTGCTGCCTGGTGGCCGGAGT
GTTGAGTGCCCCCCAGTTTGGATATGGATTCGCACCATATGGAGGATACG
GAGGATACGGAGGATATGGAGGAAGCTATGCCTCCGCCTCTGCCAGCAGC
AGTGCGGGAGGATATCAAGGATTCGGATACCCAGGATACGGGGGATATGG
AGGATACGGAGGATTTGGTGGAGGATACGGTGGAGGCTATGGGCAGCAAT
ACAACCAGTTTAGCAACTACAACAACTACGGATCTTCTGGCTACTACGGC
GGTTACCCATTCGGCAGATGA

RT07511.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG34281-RA 321 CG34281-RA 1..321 1..321 1605 100 Plus
CG14327.a 579 CG14327.a 64..299 1..236 1180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:12:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13437309..13437624 5..320 1565 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:12:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17612975..17613291 5..321 1585 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17353806..17354122 5..321 1585 100 Plus
Blast to na_te.dros performed on 2019-03-15 17:12:46 has no hits.

RT07511.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed on 2019-03-15 17:13:40 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 12:14:09 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 1..320 1..320 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:17 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 1..320 1..320 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:28:38 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 1..321 1..321 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:36 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 1..321 1..321 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 12:14:08 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 1..320 1..320 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:16 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 1..320 1..320 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:28:38 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 1..320 1..320 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:36 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
CG34281-RA 15..334 1..320 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:40 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17612969..17613290 1..320 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:40 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17612969..17613290 1..320 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:13:40 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17612969..17613290 1..320 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:28:38 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13438691..13439012 1..320 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:32 Download gff for RT07511.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17353800..17354121 1..320 99   Plus

RT07511.pep Sequence

Translation from 0 to 320

> RT07511.pep
MKYLSLSFLLCCLVAGVLSAPQFGYGFAPYGGYGGYGGYGGSYASASASS
SAGGYQGFGYPGYGGYGGYGGFGGGYGGGYGQQYNQFSNYNNYGSSGYYG
GYPFGR*

RT07511.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:45:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG34281-PA 106 CG34281-PA 1..106 1..106 604 100 Plus
CG8157-PB 113 CG8157-PB 1..94 4..101 166 42.7 Plus
CG8157-PA 113 CG8157-PA 1..94 4..101 166 42.7 Plus
Edg91-PB 151 CG7539-PB 41..144 24..105 160 42.9 Plus
Edg91-PA 159 CG7539-PA 49..152 24..105 160 42.9 Plus
CG9269-PA 146 CG9269-PA 44..118 29..105 158 48.8 Plus
CG9877-PA 88 CG9877-PA 17..86 14..80 152 47.5 Plus
Edg91-PB 151 CG7539-PB 58..141 16..101 151 45.7 Plus
Edg91-PA 159 CG7539-PA 66..149 16..101 151 45.7 Plus
CG5172-PD 172 CG5172-PD 1..120 1..101 150 35.2 Plus
Cpr47Ef-PD 601 CG13214-PD 304..356 26..81 150 55.4 Plus
Cpr47Ef-PC 612 CG13214-PC 304..356 26..81 150 55.4 Plus
CG15597-PB 149 CG15597-PB 8..124 4..105 149 39 Plus
CG14191-PA 193 CG14191-PA 41..124 24..105 148 40.8 Plus
CG9269-PA 146 CG9269-PA 49..142 30..105 147 42.6 Plus
CG7294-PA 127 CG7294-PA 6..83 9..101 147 42.6 Plus
Edg91-PB 151 CG7539-PB 50..139 23..105 146 41.4 Plus
Edg91-PA 159 CG7539-PA 58..147 23..105 146 41.4 Plus
CG14191-PA 193 CG14191-PA 92..180 24..101 146 39 Plus
sqd-PA 321 CG16901-PA 219..309 13..99 146 42.7 Plus
Edg91-PB 151 CG7539-PB 28..86 37..102 145 47 Plus
Edg91-PA 159 CG7539-PA 36..94 37..102 145 47 Plus
CG17105-PB 103 CG17105-PB 1..103 1..100 145 38.7 Plus
CG17105-PA 103 CG17105-PA 1..103 1..100 145 38.7 Plus
CG9757-PB 127 CG9757-PB 46..123 20..101 145 45.2 Plus
CG9757-PA 127 CG9757-PA 46..123 20..101 145 45.2 Plus
sqd-PD 178 CG16901-PD 53..134 13..105 145 39.8 Plus
CG2157-PA 245 CG2157-PA 79..193 24..104 145 37.4 Plus
sqd-PB 344 CG16901-PB 219..300 13..105 145 39.8 Plus
CG8160-PA 212 CG8160-PA 27..115 22..100 143 42.7 Plus
CG3588-PF 631 CG3588-PF 554..630 24..97 143 39 Plus
CG3588-PH 659 CG3588-PH 582..658 24..97 143 39 Plus
CG3588-PG 659 CG3588-PG 582..658 24..97 143 39 Plus
CG3588-PI 662 CG3588-PI 585..661 24..97 143 39 Plus
CG3588-PE 891 CG3588-PE 582..658 24..97 143 39 Plus
TwdlT-PA 286 CG5812-PA 43..120 24..101 142 40 Plus
Pex13-PA 440 CG4663-PA 70..136 30..87 142 46.3 Plus
CG9083-PB 317 CG9083-PB 172..266 30..105 141 40 Plus
Pex13-PA 440 CG4663-PA 70..133 33..102 141 45.1 Plus
CG10598-PC 173 CG10598-PC 74..161 31..102 140 40 Plus
CG10598-PA 173 CG10598-PA 74..161 31..102 140 40 Plus
sqd-PC 308 CG16901-PC 219..293 13..101 140 40.4 Plus
sqd-PE 308 CG16901-PE 219..293 13..101 140 40.4 Plus
CG17738-PA 110 CG17738-PA 51..105 22..81 138 52.2 Plus
CG9269-PA 146 CG9269-PA 62..146 24..104 137 44.2 Plus
CG14191-PA 193 CG14191-PA 55..137 24..105 137 42.9 Plus
CG17777-PC 110 CG17777-PC 49..110 23..80 136 43.5 Plus
CG17777-PB 110 CG17777-PB 49..110 23..80 136 43.5 Plus
CG5172-PC 106 CG5172-PC 1..86 1..80 135 36.8 Plus
CG17777-PC 110 CG17777-PC 47..102 25..104 133 43.8 Plus
CG17777-PB 110 CG17777-PB 47..102 25..104 133 43.8 Plus
CG14563-PA 122 CG14563-PA 26..122 19..100 133 40.8 Plus

RT07511.hyp Sequence

Translation from 0 to 318

> RT07511.hyp
SQYLSLSFLLCCLVAGVLSAPQFGYGFAPYGGYGGYGGYGGSYASASASS
SAGGYQGFGYPGYGGYGGYGGFGGGYGGGYGQQYNQFSNYNNYGSSGYYG
GYPFGR

RT07511.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34281-PA 106 CG34281-PA 2..106 2..106 595 99 Plus
CG8157-PB 113 CG8157-PB 1..94 4..101 166 42.7 Plus
CG8157-PA 113 CG8157-PA 1..94 4..101 166 42.7 Plus
Edg91-PB 151 CG7539-PB 41..144 24..105 160 42.9 Plus
Edg91-PA 159 CG7539-PA 49..152 24..105 160 42.9 Plus
Edg91-PB 151 CG7539-PB 58..141 16..101 151 45.7 Plus
Edg91-PB 151 CG7539-PB 50..139 23..105 146 41.4 Plus
Edg91-PB 151 CG7539-PB 28..86 37..102 145 47 Plus