Clone RT07515 Report

Search the DGRC for RT07515

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:75
Well:15
Vector:pCR2.1
Associated Gene/TranscriptCG14673-RA
Protein status:RT07515.pep: wuzgold
Sequenced Size:381

Clone Sequence Records

RT07515.complete Sequence

381 bp assembled on 2011-07-27

GenBank Submission: BT124786.2

> RT07515.complete
ATGAAATTGAGCTACACCTGTGGCGCCCCAGCGGATTCAGGGGCTCCCAC
TTTGAACGAGGCAAAGCCAGATGATTCCGATGAGTCCGTAGAGACCTCTC
CACCGACCTACTGGAACAGTGGGTATTGGATAACGACCACACCGCTGCCG
CCGATCACCAACTTGCCGGGTGCGGACAAGGAGGTCCTGTGCCAATTTCT
GGGTTTCTTCGAGGCATTTAGAATGCTACTCTTCACGCTTCTCTGGGGCG
CTAACATGGAGTTCTGTCCAACGCGGAGAAGCACGTCGCCAGCGAGCTTC
GAGAGGAAATTGAAAGGCAGCGCAACTCATCCTCGGACCGCAAGTACATG
GAAATGGACCCAACGCAAGCGAACGCAATAG

RT07515.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14673-RA 381 CG14673-RA 1..380 1..380 1900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1452152..1452524 381..9 1865 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5626494..5626866 381..9 1865 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5367325..5367697 381..9 1865 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:50:31 has no hits.

RT07515.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:36 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1452152..1452524 9..381 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-23 14:37:48 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14673-RA 1..379 1..379 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:26 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14673-RA 1..381 1..381 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-23 14:37:47 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14673-RA 1..379 1..379 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:25 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
CG14673-RA 1..381 1..381 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:36 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5626494..5626866 9..381 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:36 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5626494..5626866 9..381 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:36 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5626494..5626866 9..381 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:24 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1452216..1452588 9..381 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:24 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1452216..1452588 9..381 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:24 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1452216..1452588 9..381 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:54 Download gff for RT07515.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5367325..5367697 9..381 100   Minus

RT07515.pep Sequence

Translation from 0 to 380

> RT07515.pep
MKLSYTCGAPADSGAPTLNEAKPDDSDESVETSPPTYWNSGYWITTTPLP
PITNLPGADKEVLCQFLGFFEAFRMLLFTLLWGANMEFCPTRRSTSPASF
ERKLKGSATHPRTASTWKWTQRKRTQ*

RT07515.pep Blast Records

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10609-PA 238 GM10609-PA 12..119 3..114 375 63.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19597-PA 238 GD19597-PA 12..119 3..114 376 63.4 Plus

RT07515.hyp Sequence

Translation from 9 to 378

> RT07515.hyp
SYTCGAPADSGAPTLNEAKPDDSDESVETSPPTYWNSGYWITTTPLPPIT
NLPGADKEVLCQFLGFFEAFRMLLFTLLWGANMEFCPTRRSTSPASFERK
LKGSATHPRTASTWKWTQRKRTQ
Sequence RT07515.hyp has no blast hits.

RT07515.hyp2 Sequence

Translation from 9 to 380

> RT07515.hyp2
SYTCGAPADSGAPTLNEAKPDDSDESVETSPPTYWNSGYWITTTPLPPIT
NLPGADKEVLCQFLGFFEAFRMLLFTLLWGANMEFCPTRRSTSPASFERK
LKGSATHPRTASTWKWTQRKRTQ*
Sequence RT07515.hyp2 has no blast hits.