Clone RT07545 Report

Search the DGRC for RT07545

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:75
Well:45
Vector:pCR2.1
Associated Gene/TranscriptCG14111-RA
Protein status:RT07545.pep: wuzgold
Sequenced Size:711

Clone Sequence Records

RT07545.complete Sequence

711 bp assembled on 2010-04-26

GenBank Submission: BT124823.1

> RT07545.complete
ATGTGCTCTGGCCAGAATGTAACGAAATCAAACAATAGCCAGGACATCAT
CACAGTGAAGGTCTTGCCGCAGTCAATATCTTCAGATCCTTCAACTGGTT
CTTCCAGCTCAACCACCGCCACACCCACAGCCACAACTCCCAAACTAAAA
TCCAATCCTACAGCCAAGTCCGCCATACAGGCTCACGAAATCGAGGAGGA
GGACGACGACTTCCACAACGATCGTCTTCCCGCCTTATCAGAGGATGAGT
ACAACAACCTGAGTGAGGACGCCAATCCGCTGCACTTCCTTAAGCAACAG
CCCCTGGATCTTGAAAATGTGGAGCCGCAGCAGAAGCCTGAATCTCAAAC
CGAGAGTAAGCCAGATCCGCAAGTGATGGCTCCACAAACCGCCGGCTCAC
CCATCTACATAACCATTCCCATTTACATAAGCACGGGCGGTAAGCTGCCC
ATTAGTTTGACCATTGGAGATCAGGATTTGTCATTGAAAAAGGAAAGCGG
ATCTGGATCCAGCAAGAAGAATCACTCTACCAAATCACCGAACTCGTTCT
TCAATCGCTTGCTGCAGCAGATTGAGTCTCCCAAGAGACGAACCACCAAT
CGCCATCGCAGCCAACTCAAGAGTCACGTATATGCGATGAAGGAGATGGA
CAACCAGGGGAACAAGGATGGCAAGAAACTCAAGATTTTGCTTCATAGCC
CAATGCAATAA

RT07545.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG14111-RA 792 CG14111-RA 82..792 1..711 3555 100 Plus
CG14107-RA 1363 CG14107-RA 1319..1363 711..667 225 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13370225..13370610 324..709 1855 98.7 Plus
chr3L 24539361 chr3L 13369526..13369849 1..324 1575 99.1 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13379992..13380380 323..711 1945 100 Plus
3L 28110227 3L 13379292..13379615 1..324 1620 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13373092..13373480 323..711 1945 100 Plus
3L 28103327 3L 13372392..13372715 1..324 1620 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:07:12 has no hits.

RT07545.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:08:17 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13369526..13369849 1..324 99 -> Plus
chr3L 13370226..13370612 325..711 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 17:06:37 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RA 1..709 1..709 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:41 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RA 1..711 1..711 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:03:08 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RB 52..762 1..711 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:28 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RB 52..762 1..711 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 17:06:36 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RA 1..709 1..709 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:41 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RA 1..711 1..711 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:03:08 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RB 52..762 1..711 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:28 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
CG14111-RB 82..792 1..711 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:17 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13379292..13379615 1..324 100 -> Plus
3L 13379994..13380380 325..711 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:17 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13379292..13379615 1..324 100 -> Plus
3L 13379994..13380380 325..711 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:08:17 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13379292..13379615 1..324 100 -> Plus
3L 13379994..13380380 325..711 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:03:08 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13372392..13372715 1..324 100 -> Plus
arm_3L 13373094..13373480 325..711 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:13 Download gff for RT07545.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13372392..13372715 1..324 100 -> Plus
3L 13373094..13373480 325..711 100   Plus

RT07545.pep Sequence

Translation from 0 to 710

> RT07545.pep
MCSGQNVTKSNNSQDIITVKVLPQSISSDPSTGSSSSTTATPTATTPKLK
SNPTAKSAIQAHEIEEEDDDFHNDRLPALSEDEYNNLSEDANPLHFLKQQ
PLDLENVEPQQKPESQTESKPDPQVMAPQTAGSPIYITIPIYISTGGKLP
ISLTIGDQDLSLKKESGSGSSKKNHSTKSPNSFFNRLLQQIESPKRRTTN
RHRSQLKSHVYAMKEMDNQGNKDGKKLKILLHSPMQ*

RT07545.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24040-PA 348 GF24040-PA 121..338 1..215 493 57.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15637-PA 228 GG15637-PA 1..228 1..236 727 76.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:37:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17160-PA 233 GH17160-PA 48..215 43..209 291 44.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14111-PB 253 CG14111-PB 18..253 1..236 1213 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:37:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11775-PA 236 GI11775-PA 15..234 1..225 367 44.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15711-PA 226 GL15711-PA 7..213 1..215 492 57 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:37:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12767-PA 226 GA12767-PA 7..213 1..215 491 57 Plus
Dpse\GA29256-PA 96 GA29256-PA 4..83 128..215 291 67.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25415-PA 232 GM25415-PA 1..232 1..236 855 83.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:37:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14445-PA 232 GD14445-PA 1..232 1..236 961 86.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:37:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13477-PA 232 GJ13477-PA 54..217 40..217 374 57.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17440-PA 186 GK17440-PA 21..185 38..218 367 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:37:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21965-PA 245 GE21965-PA 13..245 1..236 811 82.2 Plus

RT07545.hyp Sequence

Translation from 1 to 708

> RT07545.hyp
MCSGQNVTKSNNSQDIITVKVLPQSISSDPSTGSSSSTTATPTATTPKLK
SNPTAKSAIQAHEIEEEDDDFHNDRLPALSEDEYNNLSEDANPLHFLKQQ
PLDLENVEPQQKPESQTESKPDPQVMAPQTAGSPIYITIPIYISTGGKLP
ISLTIGDQDLSLKKESGSGSSKKNHSTKSPNSFFNRLLQQIESPKRRTTN
RHRSQLKSHVYAMKEMDNQGNKDGKKLKILLHSPMQ

RT07545.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14111-PB 253 CG14111-PB 18..253 1..236 1213 100 Plus