Clone RT07610 Report

Search the DGRC for RT07610

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:76
Well:10
Vector:pCR2.1
Associated Gene/TranscriptCG13202-RA
Protein status:RT07610.pep: gold
Sequenced Size:319

Clone Sequence Records

RT07610.complete Sequence

319 bp assembled on 2010-04-26

GenBank Submission: BT124796.1

> RT07610.complete
CTTTTGAGAGATAATACCGACATGGATAACTGGAAGATAACCGCGGAGGA
GCTTATCCGTCTGCGGGAGAGCTGCTTGCAGTGCATCCGTGATGGAGAAC
TCTATGAACTGCGCAACGATGCCAAACTTAGGGCTGTTTATAGCACTCAG
AACTACGAAGAATTCAAGAACATAGTGGATGCGGCTCATCTTCGTCCAGT
GACCAAGGGCGACAAGGCGAATTTTAAGACGAAGAATCGACTATGGAACT
CGGCGGCCCGGGATTAATTTGTTAATTGCGCAATAAAAATAAAAGACCAA
GTTTATAGTCAGAATATAC

RT07610.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13202-RA 426 CG13202-RA 108..426 1..319 1595 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:31:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7243776..7243943 168..1 825 99.4 Minus
chr2R 21145070 chr2R 7243564..7243719 319..164 765 99.4 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11356326..11356493 168..1 840 100 Minus
2R 25286936 2R 11356114..11356269 319..164 765 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11357525..11357692 168..1 840 100 Minus
2R 25260384 2R 11357313..11357468 319..164 765 99.3 Minus
Blast to na_te.dros performed on 2019-03-16 02:31:26 has no hits.

RT07610.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:32:31 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7243564..7243715 168..319 100 <- Minus
chr2R 7243777..7243943 1..167 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 12:50:40 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 1..246 22..267 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:28 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 1..246 22..267 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:14 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 1..246 22..267 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:54 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 1..246 22..267 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 12:50:40 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 1..319 1..319 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:28 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 1..319 1..319 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:14 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 108..426 1..319 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:54 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
CG13202-RA 108..426 1..319 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:31 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11356114..11356265 168..319 100 <- Minus
2R 11356327..11356493 1..167 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:31 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11356114..11356265 168..319 100 <- Minus
2R 11356327..11356493 1..167 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:32:31 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11356114..11356265 168..319 100 <- Minus
2R 11356327..11356493 1..167 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:14 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7243619..7243770 168..319 100 <- Minus
arm_2R 7243832..7243998 1..167 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:39 Download gff for RT07610.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11357313..11357464 168..319 100 <- Minus
2R 11357526..11357692 1..167 100   Minus

RT07610.hyp Sequence

Translation from 0 to 266

> RT07610.hyp
LLRDNTDMDNWKITAEELIRLRESCLQCIRDGELYELRNDAKLRAVYSTQ
NYEEFKNIVDAAHLRPVTKGDKANFKTKNRLWNSAARD*

RT07610.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:58:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG13202-PA 81 CG13202-PA 1..81 8..88 427 100 Plus

RT07610.pep Sequence

Translation from 0 to 266

> RT07610.pep
LLRDNTDMDNWKITAEELIRLRESCLQCIRDGELYELRNDAKLRAVYSTQ
NYEEFKNIVDAAHLRPVTKGDKANFKTKNRLWNSAARD*

RT07610.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12401-PA 81 GF12401-PA 1..81 8..88 378 86.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22657-PA 81 GG22657-PA 1..81 8..88 396 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22863-PA 80 GH22863-PA 5..80 13..88 292 71.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG13202-PA 81 CG13202-PA 1..81 8..88 427 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21242-PA 83 GI21242-PA 3..82 9..88 279 67.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17337-PA 81 GL17337-PA 1..81 8..88 321 75.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12117-PA 81 GA12117-PA 1..81 8..88 321 75.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20438-PA 81 GM20438-PA 1..81 8..88 411 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:25:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15254-PA 83 GD15254-PA 2..83 7..88 417 95.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20846-PA 85 GJ20846-PA 3..82 9..88 295 71.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:25:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19453-PA 83 GK19453-PA 5..83 10..88 312 73.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:25:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13532-PA 81 GE13532-PA 1..81 8..88 406 92.6 Plus