Clone RT07631 Report

Search the DGRC for RT07631

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:76
Well:31
Vector:pCR2.1
Associated Gene/TranscriptCG13692-RA
Protein status:RT07631.pep: gold
Sequenced Size:582

Clone Sequence Records

RT07631.complete Sequence

582 bp assembled on 2010-04-27

GenBank Submission: BT124848.1

> RT07631.complete
ATGTCCACCTGCATTTGCTTGGGCCCCAAAAGAGCGGGCAAAACGCACCT
TTTGAAAGCTTTACAGGATCCGGAATCCATCGATGAGACCACGTTTTCCA
TGCCCACCATTGGCACTGGGATTTACCGAATCCATTTCCCAACAAAATCG
CCAAATGGGGATAAAAATAAGCCTCCTCCCTCAGAAGCTCCAGCTAACAT
TCCTCATGGCGGTAAAAATCTGCCCAAGTCCATACAGATCCTGGAAATTG
GAGGGAGTATGGCCCCCTTGTGGAGGCAGTATTTCGAGGATGTCAAGAAG
CTGATCTACGTCGTGGACACCTCTAATCTCTGTCAGATTTCAGCCGCCGG
CGTTCTTTTCTATTCAATCCTCACCGAGCCGCGTCTGCAGCATAATACTA
AGATCCTGTTGGTACTGGCCAAAATGGATTACTCCTACCGCCAGATGCGA
AACGAGGCTCTGCTCATGCTGCAGATGCAGAAGTTGCAAAAACAGATCCG
CCAGCAGGTGACCATCGTGGAGGCCAGCGCCGTCACCAAAGTGGGCTTAG
ACCCCATCTACGATTGGCTGCAGAGACCCTAA

RT07631.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG13692-RA 954 CG13692-RA 111..692 1..582 2910 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:02:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 421811..422200 1..390 1935 99.7 Plus
chr2L 23010047 chr2L 422254..422444 390..580 940 99.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:02:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 421800..422189 1..390 1950 100 Plus
2L 23513712 2L 422243..422435 390..582 965 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 421800..422189 1..390 1950 100 Plus
2L 23513712 2L 422243..422435 390..582 965 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:02:25 has no hits.

RT07631.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:03:03 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 421811..422199 1..389 99 -> Plus
chr2L 422254..422446 390..582 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-27 11:48:06 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:44 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 1..582 1..582 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:22:38 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 1..582 1..582 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:35:23 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 1..582 1..582 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-27 11:48:05 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 1..580 1..580 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:44 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 1..582 1..582 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:22:38 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 30..611 1..582 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:35:23 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
CG13692-RA 30..611 1..582 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:03:03 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 421800..422188 1..389 100 -> Plus
2L 422243..422435 390..582 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:03:03 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 421800..422188 1..389 100 -> Plus
2L 422243..422435 390..582 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:03:03 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 421800..422188 1..389 100 -> Plus
2L 422243..422435 390..582 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:22:38 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 421800..422188 1..389 100 -> Plus
arm_2L 422243..422435 390..582 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:56:26 Download gff for RT07631.complete
Subject Subject Range Query Range Percent Splice Strand
2L 421800..422188 1..389 100 -> Plus
2L 422243..422435 390..582 100   Plus

RT07631.pep Sequence

Translation from 0 to 581

> RT07631.pep
MSTCICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKS
PNGDKNKPPPSEAPANIPHGGKNLPKSIQILEIGGSMAPLWRQYFEDVKK
LIYVVDTSNLCQISAAGVLFYSILTEPRLQHNTKILLVLAKMDYSYRQMR
NEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWLQRP*

RT07631.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20655-PA 195 GF20655-PA 1..195 1..193 932 90.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:41:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24718-PA 193 GG24718-PA 1..193 1..193 1011 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11224-PA 195 GH11224-PA 2..195 3..193 833 82.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13692-PA 193 CG13692-PA 1..193 1..193 1006 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21668-PA 195 GI21668-PA 2..195 3..193 834 83.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18877-PA 193 GL18877-PA 2..193 3..193 867 86.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12463-PA 193 GA12463-PA 2..193 3..193 868 86.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16741-PA 193 GM16741-PA 1..193 1..193 1015 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23024-PA 193 GD23024-PA 1..193 1..193 1022 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17776-PA 196 GJ17776-PA 2..196 3..193 776 79.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15454-PA 179 GK15454-PA 1..179 1..193 814 82.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:41:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16814-PA 193 GE16814-PA 1..193 1..193 1025 99 Plus

RT07631.hyp Sequence

Translation from 1 to 579

> RT07631.hyp
MSTCICLGPKRAGKTHLLKALQDPESIDETTFSMPTIGTGIYRIHFPTKS
PNGDKNKPPPSEAPANIPHGGKNLPKSIQILEIGGSMAPLWRQYFEDVKK
LIYVVDTSNLCQISAAGVLFYSILTEPRLQHNTKILLVLAKMDYSYRQMR
NEALLMLQMQKLQKQIRQQVTIVEASAVTKVGLDPIYDWLQRP

RT07631.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13692-PA 193 CG13692-PA 1..193 1..193 1006 100 Plus