Clone RT07670 Report

Search the DGRC for RT07670

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:76
Well:70
Vector:pCR2.1
Associated Gene/TranscriptCG30288-RC
Protein status:RT07670.pep: gold
Sequenced Size:849

Clone Sequence Records

RT07670.complete Sequence

849 bp assembled on 2010-04-26

GenBank Submission: BT124797.1

> RT07670.complete
ATGCGTCTACCTATACGGCAGCTTGTGATAGTAGCCTGTCTTTTTATTGG
GATTATCCGGACGGAATCCGGACGCTTACTGGAAAACGACTGTGGAACCA
CGAGCAGTAATGGTTATAGAGCGCGAATCGATGGAGGTAGAGATGCTGGC
ATGGAATCGAACCCCTGGATGGTCAGAGTAATGATTTCGGGAAAAGCAGT
GTGTGGCGGTTCACTTATAACTGCTCGATTTGTTTTGACCGCCGAGCATT
GCATTTCCCCAATGTATATGAATGTGCGCCTGGGCGAATACGATACCCGA
CATCCCATATTCGACTGCGATGATTTTGTCTGCACACCAAGGGCCTACAA
TGTGGACGTGGATAGGAAAATTGTTCATAGTAATCCAGGATATGATATTG
GTCTGTTGCGAATGCAAAGGAGTGTGATATTCTCAAACTATGTCAGACCA
ATCTGCTTGATTCTGGGCAAAACGTTGGGTGGGAACCCACTCTCAATATT
ACGCTTCAATTTCACCGGATGGGGTACAAATAGTGATGGAGAAGAGCAAG
ATAGGCTACAGACTGCCACCCTGCAACAATTACCTCAATGGAGTTGTGAA
AGACCTGGAAGACCTCTCGATATATCCTATATATGTGCCGGCAGTTATAT
CAGTGATTCGTGCAAAGGCGATTCGGGAGGTCCTTTGAGCGCAATTCGTA
CATTTGAGGGGCAGGGAAGGGTCTTCCAGTTCGGTGTCGCTAGCCAAGGA
CTTCGGTTGTGCAGTGGCTTGGGAATTTACACCAATGTCACACACTTTAC
GGACTGGATATTGGATGTTATTCAAAACCATTCAGACGACTTTGAATGA

RT07670.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG30288-RC 952 CG30288-RC 12..860 1..849 4230 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17405835..17406246 848..437 2030 99.5 Minus
chr2R 21145070 chr2R 17406642..17406868 227..1 1120 99.6 Minus
chr2R 21145070 chr2R 17406314..17406480 436..270 835 100 Minus
chr2R 21145070 chr2R 17406537..17406580 270..227 220 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21519335..21519747 849..437 2065 100 Minus
2R 25286936 2R 21520143..21520369 227..1 1120 99.6 Minus
2R 25286936 2R 21519815..21519981 436..270 835 100 Minus
2R 25286936 2R 21520038..21520081 270..227 220 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21520534..21520946 849..437 2065 100 Minus
2R 25260384 2R 21521342..21521568 227..1 1120 99.5 Minus
2R 25260384 2R 21521014..21521180 436..270 835 100 Minus
2R 25260384 2R 21521237..21521280 270..227 220 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:49:51 has no hits.

RT07670.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:50:56 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17406643..17406868 1..226 99   Minus
chr2R 17405835..17406246 437..848 99 <- Minus
chr2R 17406314..17406480 270..436 100 <- Minus
chr2R 17406538..17406580 227..269 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 13:47:58 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 1..848 1..848 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:29 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 1..848 1..848 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:13 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 1..849 1..849 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:27 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 1..849 1..849 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 13:47:57 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 1..848 1..848 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:29 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 1..848 1..848 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:13 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 25..872 1..848 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:27 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
CG30288-RC 25..872 1..848 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:56 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21519336..21519747 437..848 100 <- Minus
2R 21519815..21519981 270..436 100 <- Minus
2R 21520039..21520081 227..269 100 <- Minus
2R 21520144..21520369 1..226 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:56 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21519336..21519747 437..848 100 <- Minus
2R 21519815..21519981 270..436 100 <- Minus
2R 21520039..21520081 227..269 100 <- Minus
2R 21520144..21520369 1..226 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:56 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21519336..21519747 437..848 100 <- Minus
2R 21519815..21519981 270..436 100 <- Minus
2R 21520039..21520081 227..269 100 <- Minus
2R 21520144..21520369 1..226 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:13 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17406841..17407252 437..848 100 <- Minus
arm_2R 17407320..17407486 270..436 100 <- Minus
arm_2R 17407544..17407586 227..269 100 <- Minus
arm_2R 17407649..17407874 1..226 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:40 Download gff for RT07670.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21520535..21520946 437..848 100 <- Minus
2R 21521014..21521180 270..436 100 <- Minus
2R 21521238..21521280 227..269 100 <- Minus
2R 21521343..21521568 1..226 99   Minus

RT07670.pep Sequence

Translation from 0 to 848

> RT07670.pep
MRLPIRQLVIVACLFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAG
MESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPMYMNVRLGEYDTR
HPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRP
ICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSCE
RPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQG
LRLCSGLGIYTNVTHFTDWILDVIQNHSDDFE*

RT07670.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:25:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12091-PA 280 GF12091-PA 6..270 9..280 356 32.7 Plus
Dana\GF23281-PA 372 GF23281-PA 105..370 30..277 346 33.1 Plus
Dana\GF13370-PA 505 GF13370-PA 6..277 23..274 327 33.2 Plus
Dana\GF11318-PA 308 GF11318-PA 1..218 57..278 316 33 Plus
Dana\GF11497-PA 284 GF11497-PA 4..271 10..273 310 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:25:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20038-PA 289 GG20038-PA 1..279 1..279 571 43 Plus
Dere\GG18032-PA 282 GG18032-PA 1..281 1..278 531 42.2 Plus
Dere\GG20772-PA 333 GG20772-PA 1..282 1..276 479 38.8 Plus
Dere\GG20540-PA 291 GG20540-PA 5..281 8..278 446 38.6 Plus
Dere\GG20769-PA 285 GG20769-PA 24..278 25..270 417 39.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20624-PA 374 GH20624-PA 114..371 42..277 346 32 Plus
Dgri\GH17524-PA 374 GH17524-PA 114..371 42..277 346 32 Plus
Dgri\GH20292-PA 242 GH20292-PA 2..239 53..274 320 36 Plus
Dgri\GH20291-PA 237 GH20291-PA 15..232 67..272 316 38.4 Plus
Dgri\GH23917-PA 235 GH23917-PA 2..232 42..274 286 33.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG30288-PC 282 CG30288-PC 1..282 1..282 1511 100 Plus
CG30414-PC 305 CG30414-PC 23..302 24..282 571 44.6 Plus
CG30414-PB 305 CG30414-PB 23..302 24..282 571 44.6 Plus
CG33225-PB 292 CG33225-PB 1..284 1..280 514 39.6 Plus
CG33225-PC 307 CG33225-PC 20..299 5..280 509 39.8 Plus
CG30289-PA 316 CG30289-PA 8..273 8..272 486 41.4 Plus
CG30090-PA 291 CG30090-PA 5..281 8..278 470 41.2 Plus
CG14227-PB 286 CG14227-PB 9..285 8..278 469 40 Plus
CG30287-PA 284 CG30287-PA 6..277 5..270 436 38.5 Plus
CG30082-PB 280 CR30082-PB 22..274 25..273 414 39.7 Plus
CG33226-PC 292 CG33226-PC 13..288 10..276 409 35.8 Plus
CG30283-PB 273 CG30283-PB 10..268 8..275 406 35.5 Plus
CG33458-PA 281 CG33458-PA 24..279 26..278 392 35.8 Plus
CG30088-PB 281 CG30088-PB 1..279 1..277 391 32.8 Plus
CG33459-PA 284 CG33459-PA 24..272 26..270 383 38.4 Plus
CG10764-PA 523 CG10764-PA 1..264 5..274 368 35.5 Plus
CG30087-PA 277 CG30087-PA 9..270 10..270 362 33 Plus
CG43110-PA 483 CG43110-PA 13..263 16..279 362 33 Plus
CG43110-PB 483 CG43110-PB 13..263 16..279 362 33 Plus
CG30187-PE 489 CG30187-PE 35..272 42..282 357 37.5 Plus
CG30187-PF 500 CG30187-PF 35..272 42..282 357 37.5 Plus
grass-PA 335 CG5896-PA 68..333 30..277 356 32.1 Plus
grass-PB 377 CG5896-PB 110..375 30..277 356 32.1 Plus
CG30091-PA 526 CG30091-PA 19..277 23..274 356 31.9 Plus
CG43336-PA 279 CG43336-PA 3..278 8..277 344 33.8 Plus
CG30002-PB 311 CG30002-PB 41..310 26..279 338 35.4 Plus
CG18636-PA 349 CG18636-PA 11..281 15..273 335 33.3 Plus
CG1773-PA 317 CG1773-PA 40..310 25..279 329 34.9 Plus
CG30286-PB 277 CG30286-PB 18..269 23..271 327 32.6 Plus
CG33462-PA 300 CG33462-PA 8..276 8..277 318 30.7 Plus
CG43335-PA 281 CG43335-PA 8..279 8..277 315 32.4 Plus
CG43742-PB 474 CG43742-PB 7..257 8..274 309 34.4 Plus
CG30083-PB 279 CG30083-PB 19..263 25..278 308 33.7 Plus
CG33461-PB 287 CG33461-PB 4..282 3..274 296 31.6 Plus
ea-PA 392 CG4920-PA 116..392 27..276 296 33.8 Plus
CG30098-PA 264 CG30098-PA 5..259 10..274 282 30 Plus
CG33465-PC 488 CG33465-PC 43..267 52..276 278 32.5 Plus
CG18420-PA 299 CG18420-PA 23..275 23..279 277 31.8 Plus
SPE-PA 400 CG16705-PA 134..394 42..270 273 32 Plus
ea-PB 261 CG4920-PB 9..261 55..276 272 34 Plus
CG9733-PB 417 CG9733-PB 156..411 38..270 272 32.8 Plus
CG9733-PA 418 CG9733-PA 157..412 38..270 272 32.8 Plus
Send2-PA 239 CG18125-PA 26..229 42..274 271 34.3 Plus
CG16710-PB 372 CG16710-PB 105..363 42..271 270 32.6 Plus
Sp7-PF 391 CG3066-PF 128..390 31..275 269 32.4 Plus
Sp7-PE 391 CG3066-PE 128..390 31..275 269 32.4 Plus
Sp7-PA 391 CG3066-PA 128..390 31..275 269 32.4 Plus
CG8172-PD 371 CG8172-PD 125..368 42..276 268 32.8 Plus
CG8172-PE 545 CG8172-PE 299..542 42..276 268 32.8 Plus
CG8172-PF 561 CG8172-PF 315..558 42..276 268 32.8 Plus
CG5909-PA 381 CG5909-PA 97..381 18..275 259 29.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:25:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23202-PA 376 GI23202-PA 104..374 25..277 329 31.2 Plus
Dmoj\GI22780-PA 412 GI22780-PA 127..411 22..275 308 32.6 Plus
Dmoj\GI24877-PA 392 GI24877-PA 116..391 27..275 290 33 Plus
Dmoj\GI16576-PA 502 GI16576-PA 240..500 31..276 276 30.6 Plus
Dmoj\GI15987-PA 407 GI15987-PA 122..400 31..279 273 31.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10743-PA 279 GL10743-PA 6..275 10..275 521 41.8 Plus
Dper\GL11857-PA 283 GL11857-PA 1..278 1..276 455 39.8 Plus
Dper\GL17487-PA 304 GL17487-PA 31..285 22..278 433 37.6 Plus
Dper\GL11858-PA 345 GL11858-PA 1..283 1..275 414 37 Plus
Dper\GL16656-PA 282 GL16656-PA 9..275 8..274 400 38.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:25:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24468-PA 278 GA24468-PA 7..274 10..275 533 42.4 Plus
Dpse\GA15642-PA 283 GA15642-PA 1..278 1..276 450 39.8 Plus
Dpse\GA24175-PB 304 GA24175-PB 31..285 22..278 443 37.5 Plus
Dpse\GA25145-PA 345 GA25145-PA 1..283 1..275 415 37.4 Plus
Dpse\GA24176-PA 282 GA24176-PA 1..278 1..275 395 36.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15716-PA 251 GM15716-PA 3..250 25..278 976 73.6 Plus
Dsec\GM15551-PA 287 GM15551-PA 23..276 24..278 546 46 Plus
Dsec\GM22717-PA 299 GM22717-PA 9..294 8..274 490 40.6 Plus
Dsec\GM21631-PA 291 GM21631-PA 21..281 23..278 478 42.2 Plus
Dsec\GM15714-PA 284 GM15714-PA 6..277 5..270 436 38.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25194-PA 141 GD25194-PA 1..141 138..282 595 80 Plus
Dsim\GD24450-PA 284 GD24450-PA 9..279 8..274 516 42.8 Plus
Dsim\GD25193-PA 278 GD25193-PA 2..255 24..276 514 42.3 Plus
Dsim\GD11133-PA 295 GD11133-PA 21..281 23..278 480 42.2 Plus
Dsim\GD12740-PA 296 GD12740-PA 1..283 1..281 450 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21978-PA 296 GJ21978-PA 44..292 42..274 382 37.6 Plus
Dvir\GJ21212-PA 268 GJ21212-PA 4..265 26..274 347 35 Plus
Dvir\GJ21214-PA 280 GJ21214-PA 16..277 26..274 333 34 Plus
Dvir\GJ22863-PA 372 GJ22863-PA 113..365 42..272 323 32.7 Plus
Dvir\GJ22783-PA 401 GJ22783-PA 127..400 31..275 312 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11884-PA 375 GK11884-PA 116..370 42..274 327 32 Plus
Dwil\GK22647-PA 279 GK22647-PA 7..278 25..275 312 36.1 Plus
Dwil\GK11130-PA 392 GK11130-PA 109..391 21..275 309 34.9 Plus
Dwil\GK23933-PA 280 GK23933-PA 6..250 42..270 289 33.2 Plus
Dwil\GK13188-PA 395 GK13188-PA 121..389 31..270 284 32.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13709-PA 276 GE13709-PA 1..275 1..281 877 61.9 Plus
Dyak\GE11574-PA 456 GE11574-PA 25..277 24..278 568 47.7 Plus
Dyak\GE11725-PA 296 GE11725-PA 5..278 8..278 487 41.9 Plus
Dyak\GE13708-PA 311 GE13708-PA 6..274 8..274 477 40.9 Plus
Dyak\GE13702-PA 297 GE13702-PA 1..276 3..275 462 40.8 Plus
Dyak\GE11574-PA 456 GE11574-PA 295..456 118..277 297 40.4 Plus

RT07670.hyp Sequence

Translation from 1 to 846

> RT07670.hyp
MRLPIRQLVIVACLFIGIIRTESGRLLENDCGTTSSNGYRARIDGGRDAG
MESNPWMVRVMISGKAVCGGSLITARFVLTAEHCISPMYMNVRLGEYDTR
HPIFDCDDFVCTPRAYNVDVDRKIVHSNPGYDIGLLRMQRSVIFSNYVRP
ICLILGKTLGGNPLSILRFNFTGWGTNSDGEEQDRLQTATLQQLPQWSCE
RPGRPLDISYICAGSYISDSCKGDSGGPLSAIRTFEGQGRVFQFGVASQG
LRLCSGLGIYTNVTHFTDWILDVIQNHSDDFE

RT07670.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:58:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG30288-PC 282 CG30288-PC 1..282 1..282 1511 100 Plus
CG30414-PC 305 CG30414-PC 23..302 24..282 571 44.6 Plus
CG30414-PB 305 CG30414-PB 23..302 24..282 571 44.6 Plus
CG33225-PB 292 CG33225-PB 1..284 1..280 514 39.6 Plus
CG33225-PC 307 CG33225-PC 20..299 5..280 509 39.8 Plus