Clone Sequence Records
RT07727.complete Sequence
518 bp assembled on 2011-07-27
GenBank Submission: BT124808.2
> RT07727.complete
ACGGAAAAGTGAAAATGGTTAATCGTAACGGGAGACTGTCACAGCATTTA
TATGAACTAAATAAGTGCGAACAGGAGTCAGAGCTGACCACAATTTCGGG
TATAAATATGCTCCACGCAGAGGAGTGGGATATCAAAGAGCTTCTAGCCT
TCCGAAAAAGCACAACACAACGAAATATTCCACCATGTTCAAATACGCCG
TCCTTGTCCTGATAACCGTCGCCTGCGCTGCTGCCAAGCCCGATCTCCTG
GGTGCTGCCCTGGCGTACACTGGTCCTCTGGCTTACTCTGCTCCTCTAGA
CTACTCTGCTCTCGCTGCCGTGGTAACTGCTCCCACTCCACCTGTGACCG
CCACCAGTATCGCCAGGAACAACAATGGAATCGATGCTGCTTCTGAGATT
GCTTCCGTTGCTGCTCCAGTGGTGGCCAAGTACGCTGCTGCTTCTTTGGC
CTACCCTTCGCGTTTGGCCAACTCCGCTCCAATCAGCTGCGCCTCTGCTG
CTGCGCAGGTCATCATCA
RT07727.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 16:48:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32212-RA | 520 | CG32212-RA | 1..517 | 1..517 | 2585 | 100 | Plus |
nc_13497.b | 846 | nc_13497.b | 36..356 | 517..197 | 1605 | 100 | Minus |
nc_13497.a | 962 | nc_13497.a | 44..364 | 517..197 | 1605 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 19477460..19477780 | 197..517 | 1590 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 19477205..19477401 | 1..197 | 985 | 100 | Plus |
chr3L | 24539361 | chr3L | 19413254..19413472 | 197..406 | 700 | 89 | Plus |
chr3L | 24539361 | chr3L | 19456092..19456364 | 480..217 | 685 | 84.2 | Minus |
chr3L | 24539361 | chr3L | 19467778..19467996 | 197..406 | 685 | 88.6 | Plus |
chr3L | 24539361 | chr3L | 19464617..19464860 | 451..217 | 615 | 84.4 | Minus |
chr3L | 24539361 | chr3L | 19462053..19462295 | 217..450 | 610 | 84.4 | Plus |
chr3L | 24539361 | chr3L | 19461588..19461782 | 197..1 | 545 | 86.3 | Minus |
chr3L | 24539361 | chr3L | 19465131..19465325 | 1..197 | 545 | 86.3 | Plus |
chr3L | 24539361 | chr3L | 19413016..19413195 | 15..197 | 455 | 85.8 | Plus |
chr3L | 24539361 | chr3L | 19467540..19467721 | 13..197 | 435 | 84.9 | Plus |
chr3L | 24539361 | chr3L | 19456661..19456834 | 13..197 | 375 | 82.7 | Plus |
chr3L | 24539361 | chr3L | 19467996..19468069 | 444..517 | 340 | 97.3 | Plus |
chr3L | 24539361 | chr3L | 19413472..19413539 | 444..511 | 325 | 98.5 | Plus |
chr3L | 24539361 | chr3L | 19456952..19457104 | 274..417 | 310 | 81.7 | Plus |
chr3L | 24539361 | chr3L | 19465443..19465595 | 274..417 | 295 | 81 | Plus |
chr3L | 24539361 | chr3L | 19461318..19461470 | 417..274 | 295 | 81 | Minus |
chr3L | 24539361 | chr3L | 19461431..19461509 | 295..217 | 275 | 89.9 | Minus |
chr3L | 24539361 | chr3L | 19465404..19465482 | 217..295 | 275 | 89.9 | Plus |
chr3L | 24539361 | chr3L | 19414231..19414275 | 410..454 | 195 | 95.6 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 19488025..19488345 | 197..517 | 1605 | 100 | Plus |
3L | 28110227 | 3L | 19487770..19487966 | 1..197 | 985 | 100 | Plus |
3L | 28110227 | 3L | 19478353..19478571 | 197..406 | 715 | 89.5 | Plus |
3L | 28110227 | 3L | 19423829..19424047 | 197..406 | 700 | 89 | Plus |
3L | 28110227 | 3L | 19466670..19466942 | 480..217 | 670 | 83.9 | Minus |
3L | 28110227 | 3L | 19475194..19475437 | 451..217 | 615 | 84.4 | Minus |
3L | 28110227 | 3L | 19472630..19472872 | 217..450 | 610 | 84.4 | Plus |
3L | 28110227 | 3L | 19472165..19472359 | 197..1 | 545 | 86.3 | Minus |
3L | 28110227 | 3L | 19475708..19475902 | 1..197 | 545 | 86.3 | Plus |
3L | 28110227 | 3L | 19423591..19423770 | 15..197 | 455 | 85.8 | Plus |
3L | 28110227 | 3L | 19467239..19467412 | 13..197 | 375 | 82.7 | Plus |
3L | 28110227 | 3L | 19478117..19478296 | 13..197 | 370 | 83.8 | Plus |
3L | 28110227 | 3L | 19424047..19424120 | 444..517 | 340 | 97.3 | Plus |
3L | 28110227 | 3L | 19478571..19478644 | 444..517 | 340 | 97.3 | Plus |
3L | 28110227 | 3L | 19467530..19467682 | 274..417 | 295 | 81 | Plus |
3L | 28110227 | 3L | 19471895..19472047 | 417..274 | 295 | 81 | Minus |
3L | 28110227 | 3L | 19476020..19476172 | 274..417 | 280 | 80.4 | Plus |
3L | 28110227 | 3L | 19467491..19467569 | 217..295 | 275 | 89.9 | Plus |
3L | 28110227 | 3L | 19472008..19472086 | 295..217 | 275 | 89.9 | Minus |
3L | 28110227 | 3L | 19475981..19476059 | 217..295 | 275 | 89.9 | Plus |
3L | 28110227 | 3L | 19424825..19424869 | 410..454 | 195 | 95.6 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:13:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 19481125..19481445 | 197..517 | 1605 | 100 | Plus |
3L | 28103327 | 3L | 19480870..19481066 | 1..197 | 985 | 100 | Plus |
3L | 28103327 | 3L | 19471453..19471615 | 197..359 | 635 | 92.6 | Plus |
3L | 28103327 | 3L | 19416929..19417091 | 197..359 | 620 | 92 | Plus |
3L | 28103327 | 3L | 19468808..19469002 | 1..197 | 560 | 87.3 | Plus |
3L | 28103327 | 3L | 19465265..19465459 | 197..1 | 560 | 87.3 | Minus |
3L | 28103327 | 3L | 19416691..19416870 | 15..197 | 480 | 86.8 | Plus |
3L | 28103327 | 3L | 19465730..19465872 | 217..359 | 430 | 86.7 | Plus |
3L | 28103327 | 3L | 19459900..19460042 | 359..217 | 430 | 86.7 | Minus |
3L | 28103327 | 3L | 19468395..19468537 | 359..217 | 430 | 86.7 | Minus |
3L | 28103327 | 3L | 19460375..19460512 | 58..197 | 380 | 87.1 | Plus |
3L | 28103327 | 3L | 19459770..19459892 | 480..358 | 375 | 86.9 | Minus |
3L | 28103327 | 3L | 19471217..19471363 | 13..162 | 370 | 85.3 | Plus |
3L | 28103327 | 3L | 19417147..19417220 | 444..517 | 340 | 97.2 | Plus |
3L | 28103327 | 3L | 19471671..19471744 | 444..517 | 340 | 97.2 | Plus |
3L | 28103327 | 3L | 19468294..19468387 | 451..358 | 320 | 89.3 | Minus |
3L | 28103327 | 3L | 19465880..19465972 | 358..450 | 315 | 89.2 | Plus |
3L | 28103327 | 3L | 19465108..19465186 | 295..217 | 275 | 89.8 | Minus |
3L | 28103327 | 3L | 19469081..19469159 | 217..295 | 275 | 89.8 | Plus |
3L | 28103327 | 3L | 19460591..19460669 | 217..295 | 275 | 89.8 | Plus |
3L | 28103327 | 3L | 19460630..19460715 | 274..359 | 235 | 84.8 | Plus |
3L | 28103327 | 3L | 19469120..19469205 | 274..359 | 235 | 84.8 | Plus |
3L | 28103327 | 3L | 19465062..19465147 | 359..274 | 235 | 84.8 | Minus |
3L | 28103327 | 3L | 19471623..19471671 | 358..406 | 215 | 95.9 | Plus |
3L | 28103327 | 3L | 19417099..19417147 | 358..406 | 215 | 95.9 | Plus |
3L | 28103327 | 3L | 19417925..19417969 | 410..454 | 195 | 95.5 | Plus |
3L | 28103327 | 3L | 19460724..19460782 | 359..417 | 190 | 88.1 | Plus |
3L | 28103327 | 3L | 19464995..19465053 | 417..359 | 190 | 88.1 | Minus |
3L | 28103327 | 3L | 19469213..19469272 | 358..417 | 180 | 86.6 | Plus |
3L | 28103327 | 3L | 19460339..19460380 | 13..54 | 150 | 90.4 | Plus |
3L | 28103327 | 3L | 19468216..19468257 | 451..410 | 150 | 90.4 | Minus |
3L | 28103327 | 3L | 19468256..19468293 | 450..413 | 145 | 92.1 | Minus |
Blast to na_te.dros performed 2019-03-15 10:50:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\TART | 8500 | Dvir\TART TARTVIR 8500bp | 2757..2819 | 446..381 | 142 | 72.7 | Minus |
RT07727.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:37 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 19477460..19477780 | 197..517 | 99 | | Plus |
chr3L | 19477205..19477400 | 1..196 | 100 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 16:56:18 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 1..333 | 185..517 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:26 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 1..333 | 185..518 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:26 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 1..333 | 185..518 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:08 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 1..333 | 185..518 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 16:56:18 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 1..333 | 185..517 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:26 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 1..333 | 185..517 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:26 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 1..517 | 1..517 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:08 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG32212-RA | 211..727 | 1..517 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:37 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19487770..19487965 | 1..196 | 100 | -> | Plus |
3L | 19488025..19488345 | 197..517 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:37 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19487770..19487965 | 1..196 | 100 | -> | Plus |
3L | 19488025..19488345 | 197..517 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:37 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19487770..19487965 | 1..196 | 100 | -> | Plus |
3L | 19488025..19488345 | 197..517 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:26 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 19481125..19481445 | 197..517 | 100 | | Plus |
arm_3L | 19480870..19481065 | 1..196 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:09:56 Download gff for
RT07727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19480870..19481065 | 1..196 | 100 | -> | Plus |
3L | 19481125..19481445 | 197..517 | 100 | | Plus |
RT07727.pep Sequence
Translation from 184 to 517
> RT07727.pep
MFKYAVLVLITVACAAAKPDLLGAALAYTGPLAYSAPLDYSALAAVVTAP
TPPVTATSIARNNNGIDAASEIASVAAPVVAKYAAASLAYPSRLANSAPI
SCASAAAQVII
RT07727.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:13:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF23675-PA | 108 | GF23675-PA | 1..97 | 1..101 | 171 | 65.1 | Plus |
Dana\GF23677-PA | 132 | GF23677-PA | 1..83 | 1..80 | 157 | 71.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:13:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG13407-PA | 135 | GG13407-PA | 1..75 | 1..83 | 204 | 66.3 | Plus |
Dere\GG13406-PA | 105 | GG13406-PA | 1..105 | 1..111 | 179 | 54.1 | Plus |
Dere\GG16035-PA | 121 | GG16035-PA | 1..69 | 1..83 | 172 | 59.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:40:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32212-PA | 111 | CG32212-PA | 1..111 | 1..111 | 535 | 100 | Plus |
CG14096-PA | 122 | CG14096-PA | 1..110 | 1..107 | 325 | 69.1 | Plus |
CG12519-PB | 131 | CG12519-PB | 1..131 | 1..111 | 318 | 61.8 | Plus |
CG12519-PA | 131 | CG12519-PA | 1..131 | 1..111 | 318 | 61.8 | Plus |
CG18294-PA | 141 | CG18294-PA | 1..115 | 1..107 | 307 | 66.1 | Plus |
CG32214-PC | 116 | CG32214-PC | 1..116 | 1..111 | 299 | 64.8 | Plus |
CG32214-PB | 116 | CG32214-PB | 1..116 | 1..111 | 299 | 64.8 | Plus |
825-Oak-PB | 129 | CG32208-PB | 1..129 | 1..111 | 286 | 59.3 | Plus |
CG32213-PB | 129 | CG32213-PB | 1..129 | 1..111 | 283 | 58.5 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:13:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI11789-PA | 104 | GI11789-PA | 1..100 | 1..106 | 132 | 48.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:13:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD12281-PA | 135 | GD12281-PA | 1..120 | 1..104 | 148 | 64.2 | Plus |
Dsim\GD12284-PA | 170 | GD12284-PA | 36..103 | 1..65 | 132 | 76.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:13:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23008-PA | 147 | GE23008-PA | 26..147 | 1..111 | 139 | 61.1 | Plus |
RT07727.hyp Sequence
Translation from 184 to 517
> RT07727.hyp
MFKYAVLVLITVACAAAKPDLLGAALAYTGPLAYSAPLDYSALAAVVTAP
TPPVTATSIARNNNGIDAASEIASVAAPVVAKYAAASLAYPSRLANSAPI
SCASAAAQVII
RT07727.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG32212-PA | 111 | CG32212-PA | 1..111 | 1..111 | 535 | 100 | Plus |
CG14096-PA | 122 | CG14096-PA | 1..110 | 1..107 | 325 | 69.1 | Plus |
CG12519-PB | 131 | CG12519-PB | 1..131 | 1..111 | 318 | 61.8 | Plus |
CG12519-PA | 131 | CG12519-PA | 1..131 | 1..111 | 318 | 61.8 | Plus |
CG18294-PA | 141 | CG18294-PA | 1..115 | 1..107 | 307 | 66.1 | Plus |