Clone RT07743 Report

Search the DGRC for RT07743

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:77
Well:43
Vector:pCR2.1
Associated Gene/TranscriptCG34297-RA
Protein status:RT07743.pep: gold
Sequenced Size:702

Clone Sequence Records

RT07743.complete Sequence

702 bp assembled on 2010-04-23

GenBank Submission: BT124787.1

> RT07743.complete
ATGTACTCCTTGCAACACCCGCAAATCGATGAATGCTTTTTAGATTCCGA
ATCAACAGTTGAGGAAGTGGTCCGGTTACTCGAAAACCTTCAAGTGCCCA
ATGAGGAGGAGGCGGAGGGCCAGGAAAAACCTAAACGGAGTCTCAAATCT
TCCACTATAACAGAGGAGAGTTTCATAATTACAGAGAGGAAAACTCCTAT
TCCAGTTATTTCCGCACCTACTTCTTCGAAAGAGAAATCAAAGCCCAGAA
CTTTCAACCGTATAGATCGAAGTAAGGATCGATTTCCCTTCATGCGCCAG
GTGGAAATGGATCTTGATCAGCGCTCAAAAGCTCGCTTGGAAAGGGAACG
AGTGGCTCAAAACTTTCGAAAATTGGGAAACGCAGAGTATCGAAAGGGTA
ACTACGAGGCTGCTATGAAAGTGTACACCGAAGCCATCGAAAATATCCGC
GACAGTCACATCCTGTACATAAATCGGGCTCTTTGTTTCATCAAATCGGG
CAAATTCAAACGAGGCATAGTCGATTGCGATTTTGTTCTGAACAAATTGG
ACGAGAAGAACCTGAGGGCGTGGATGTATCGCGCCATGGCCTACAAAGGC
CTTAACGATGAGTCCAATTTTGAGAACTGTGTAAAATATGCCCGCAAATT
CAATTCGAAGCAGATGGATTTCATTGATGATTTCCTGGAAAAGCTAAAAT
AA

RT07743.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG34297-RA 784 CG34297-RA 60..761 1..702 3510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2573319..2573585 371..105 1335 100 Minus
chr3R 27901430 chr3R 2572871..2573076 700..495 1030 100 Minus
chr3R 27901430 chr3R 2573144..2573266 494..372 615 100 Minus
chr3R 27901430 chr3R 2573636..2573740 105..1 525 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6747542..6747808 371..105 1335 100 Minus
3R 32079331 3R 6747092..6747299 702..495 1040 100 Minus
3R 32079331 3R 6747367..6747489 494..372 615 100 Minus
3R 32079331 3R 6747859..6747963 105..1 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:43:47
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6488373..6488639 371..105 1335 100 Minus
3R 31820162 3R 6487923..6488130 702..495 1040 100 Minus
3R 31820162 3R 6488198..6488320 494..372 615 100 Minus
3R 31820162 3R 6488690..6488794 105..1 525 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:30:24 has no hits.

RT07743.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:31:07 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2573637..2573740 1..104 100   Minus
chr3R 2572869..2573076 495..702 100 <- Minus
chr3R 2573144..2573266 372..494 100 <- Minus
chr3R 2573319..2573585 105..371 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-23 14:37:50 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 1..700 1..700 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:33 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:45:09 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:13:29 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-23 14:37:50 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 1..700 1..700 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:33 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:45:09 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 1..702 1..702 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:13:29 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
CG34297-RA 45..746 1..702 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:07 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6747367..6747489 372..494 100 <- Minus
3R 6747092..6747299 495..702 100 <- Minus
3R 6747542..6747808 105..371 100 <- Minus
3R 6747860..6747963 1..104 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:07 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6747367..6747489 372..494 100 <- Minus
3R 6747092..6747299 495..702 100 <- Minus
3R 6747542..6747808 105..371 100 <- Minus
3R 6747860..6747963 1..104 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:31:07 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6747367..6747489 372..494 100 <- Minus
3R 6747092..6747299 495..702 100 <- Minus
3R 6747542..6747808 105..371 100 <- Minus
3R 6747860..6747963 1..104 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:45:09 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2573582..2573685 1..104 100   Minus
arm_3R 2572814..2573021 495..702 100 <- Minus
arm_3R 2573089..2573211 372..494 100 <- Minus
arm_3R 2573264..2573530 105..371 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:13:22 Download gff for RT07743.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6488373..6488639 105..371 100 <- Minus
3R 6488691..6488794 1..104 100   Minus
3R 6487923..6488130 495..702 100 <- Minus
3R 6488198..6488320 372..494 100 <- Minus

RT07743.pep Sequence

Translation from 0 to 701

> RT07743.pep
MYSLQHPQIDECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKS
STITEESFIITERKTPIPVISAPTSSKEKSKPRTFNRIDRSKDRFPFMRQ
VEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIR
DSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKG
LNDESNFENCVKYARKFNSKQMDFIDDFLEKLK*

RT07743.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17796-PA 237 GF17796-PA 1..233 1..232 859 73.5 Plus
Dana\GF18534-PA 242 GF18534-PA 20..239 5..233 486 42.6 Plus
Dana\GF16481-PA 225 GF16481-PA 4..222 10..233 335 36.7 Plus
Dana\GF16241-PA 247 GF16241-PA 107..242 97..232 282 41.2 Plus
Dana\GF20636-PA 489 GF20636-PA 316..417 126..228 149 31.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:41:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10246-PA 233 GG10246-PA 1..233 1..233 1140 92.3 Plus
Dere\GG16942-PA 250 GG16942-PA 31..247 5..233 474 43.9 Plus
Dere\GG20410-PA 225 GG20410-PA 4..222 10..233 339 38.1 Plus
Dere\GG11320-PA 244 GG11320-PA 104..240 96..232 316 46.7 Plus
Dere\GG24711-PA 490 GG24711-PA 310..418 119..228 158 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19482-PA 216 GH19482-PA 1..213 1..233 680 55.4 Plus
Dgri\GH18212-PA 234 GH18212-PA 7..231 5..233 481 42.3 Plus
Dgri\GH19113-PA 219 GH19113-PA 74..215 91..232 315 42.3 Plus
Dgri\GH19976-PA 420 GH19976-PA 91..196 106..211 147 31.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG34297-PA 233 CG34297-PA 1..233 1..233 1200 100 Plus
CG34274-PA 250 CG34274-PA 27..247 1..233 486 44.4 Plus
CG31294-PA 225 CG31294-PA 4..222 10..233 364 38.5 Plus
CG6980-PA 250 CG6980-PA 22..242 6..233 353 34.3 Plus
Stip1-PA 490 CG2720-PA 289..418 98..228 171 28.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13995-PA 206 GI13995-PA 1..202 9..232 637 55.4 Plus
Dmoj\GI24720-PA 233 GI24720-PA 46..229 30..232 593 55.9 Plus
Dmoj\GI10166-PA 244 GI10166-PA 21..241 6..233 485 42.8 Plus
Dmoj\GI22588-PA 226 GI22588-PA 1..223 1..233 440 39.1 Plus
Dmoj\GI23567-PA 209 GI23567-PA 12..205 13..232 292 35.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22045-PA 232 GL22045-PA 1..232 1..233 819 67.9 Plus
Dper\GL12700-PA 246 GL12700-PA 25..243 5..233 515 43.2 Plus
Dper\GL11931-PA 225 GL11931-PA 4..222 10..233 315 32.2 Plus
Dper\GL13629-PA 226 GL13629-PA 86..222 96..232 310 43.1 Plus
Dper\GL25924-PA 531 GL25924-PA 297..417 106..228 145 29.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27357-PA 232 GA27357-PA 1..232 1..233 820 68.3 Plus
Dpse\GA27592-PA 246 GA27592-PA 25..243 5..233 513 43.2 Plus
Dpse\GA16156-PA 225 GA16156-PA 4..222 10..233 315 32.2 Plus
Dpse\GA20001-PA 226 GA20001-PA 86..222 96..232 310 43.1 Plus
Dpse\GA15447-PA 489 GA15447-PA 297..417 106..228 145 29.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10528-PA 239 GM10528-PA 1..239 1..233 1153 92.5 Plus
Dsec\GM24250-PA 193 GM24250-PA 25..190 59..233 429 49.1 Plus
Dsec\GM26628-PA 245 GM26628-PA 29..241 13..232 324 35.9 Plus
Dsec\GM25756-PA 218 GM25756-PA 4..215 10..233 292 36.4 Plus
Dsec\GM15022-PA 214 GM15022-PA 34..142 119..228 162 31.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19523-PA 298 GD19523-PA 1..210 1..210 1040 93.3 Plus
Dsim\GD19039-PA 248 GD19039-PA 25..245 1..233 488 45.3 Plus
Dsim\GD20333-PA 225 GD20333-PA 4..222 10..233 353 38.5 Plus
Dsim\GD21131-PA 245 GD21131-PA 29..242 13..233 325 35.7 Plus
Dsim\Hop-PA 490 GD23015-PA 310..418 119..228 158 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23936-PA 219 GJ23936-PA 1..215 1..233 715 59.7 Plus
Dvir\GJ10868-PA 232 GJ10868-PA 1..230 1..233 496 43.7 Plus
Dvir\GJ10310-PA 229 GJ10310-PA 1..226 1..233 398 34.3 Plus
Dvir\GJ10309-PA 228 GJ10309-PA 1..225 1..233 364 37 Plus
Dvir\GJ23542-PA 139 GJ23542-PA 1..135 98..232 337 47.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10830-PA 229 GK10830-PA 1..227 1..232 732 61.6 Plus
Dwil\GK11411-PA 229 GK11411-PA 7..226 7..233 449 40.6 Plus
Dwil\GK11681-PA 232 GK11681-PA 5..229 11..233 336 35.3 Plus
Dwil\GK14108-PA 225 GK14108-PA 82..221 93..232 325 43.6 Plus
Dwil\GK18373-PA 492 GK18373-PA 319..420 126..228 152 33 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25831-PA 131 GE25831-PA 1..131 103..233 675 95.4 Plus
Dyak\GE24329-PA 250 GE24329-PA 31..247 5..233 471 43.9 Plus
Dyak\GE26363-PA 225 GE26363-PA 4..222 10..233 351 39 Plus
Dyak\GE23516-PA 244 GE23516-PA 104..240 96..232 319 46.7 Plus
Dyak\Hop-PA 490 GE16725-PA 310..418 119..228 156 30.9 Plus

RT07743.hyp Sequence

Translation from 1 to 699

> RT07743.hyp
MYSLQHPQIDECFLDSESTVEEVVRLLENLQVPNEEEAEGQEKPKRSLKS
STITEESFIITERKTPIPVISAPTSSKEKSKPRTFNRIDRSKDRFPFMRQ
VEMDLDQRSKARLERERVAQNFRKLGNAEYRKGNYEAAMKVYTEAIENIR
DSHILYINRALCFIKSGKFKRGIVDCDFVLNKLDEKNLRAWMYRAMAYKG
LNDESNFENCVKYARKFNSKQMDFIDDFLEKLK

RT07743.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:34:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG34297-PA 233 CG34297-PA 1..233 1..233 1200 100 Plus
CG34274-PA 250 CG34274-PA 27..247 1..233 486 44.4 Plus
CG31294-PA 225 CG31294-PA 4..222 10..233 364 38.5 Plus
CG6980-PA 250 CG6980-PA 22..242 6..233 353 34.3 Plus
Hop-PA 490 CG2720-PA 289..418 98..228 171 28.2 Plus