Clone RT07778 Report

Search the DGRC for RT07778

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:77
Well:78
Vector:pCR2.1
Associated Gene/TranscriptCG10301-RB
Protein status:RT07778.pep: gold
Sequenced Size:921

Clone Sequence Records

RT07778.complete Sequence

921 bp assembled on 2010-04-26

GenBank Submission: BT124810.1

> RT07778.complete
ATGCGACGTCCGCTCTCGCCGACATTGGCCAAGTTGGCCGAGCAGGAGGT
GAACGAGACGCCCGACAGGATTCAGCAGGATATTATCATCCTGCGCGTGT
GGATTCGCCAGCAGCCGCATCTGCGCGCCCGCACAGATGTGGACTTCCTG
ATCGCCTTCCTCAGACGCTGCCGTTACAGCCTGGAGGAGACCAAGCGCCG
GATCGATCGCTACTTCACCCACTACAATCTATTTCCGGAGATCATGAATA
ACCGCTGTGTGACTCAAAGACTTCTGGACATCAATCGGATGGGAGTTTGT
CTCTATCCGGATATGCCAAAGGGTGATAGCCGTAGTGCCATGTTTATAGC
CCGTTTCGGTCATTTCGATCCCAATTTGTACATGCTGCGGGAGATCTATC
ATTTTTCGTCGATGGCCATGGAGGTGATTGCGCTGGAGAATGACTATGCC
AGCTTGGCGGGAATCTGCGAAATAATTGACCTCGAGGGCGTCAACTCGGA
TAAGATGCGACGCTTTGATAGGGTTCTATTTCGCAAATGGTGGAACTGGC
TCTACAATTGCAGCCCCCTTAAAGTGAAGGAGATGTATATCATAAATATG
CCCAAGGATATTCAGGGTACCGTCATGTTTCTGTACAACGTGCTTAGCAT
GCAAGTCAACTATCCGATACGCGTGCTGAAGAACAGCGAAGAGCTAATCG
AGCACATTGGCAAGGAATCGCTGCCGGAGGAGTATGGCGGTACCAATGGA
CATTTGGGTGAATGTGTGGCCTACATGGAGGACCTGTTGAATAGCTATCG
TGGTTATTTCGAGCAGGACTGCAACTACGGGACCATTGAGGAGCTGCGGC
ACGGCGAAATAGCCACATATGAGGCGGAATTTGGAGCCAATGGCTCCTTC
CGTCGTCTCAATTGGGATTGA

RT07778.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG10301-RB 1325 CG10301-RB 210..1130 1..921 4605 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:08:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19533920..19534293 293..666 1870 100 Plus
chr3R 27901430 chr3R 19533562..19533854 1..293 1465 100 Plus
chr3R 27901430 chr3R 19534408..19534662 666..920 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23710516..23710889 293..666 1870 100 Plus
3R 32079331 3R 23710158..23710450 1..293 1465 100 Plus
3R 32079331 3R 23711004..23711259 666..921 1280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23451347..23451720 293..666 1870 100 Plus
3R 31820162 3R 23450989..23451281 1..293 1465 100 Plus
3R 31820162 3R 23451835..23452090 666..921 1280 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:08:51 has no hits.

RT07778.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:09:41 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19533562..19533854 1..293 100 -> Plus
chr3R 19533921..19534293 294..666 100 -> Plus
chr3R 19534409..19534662 667..920 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 17:01:39 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..920 1..920 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:59 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..920 1..920 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:41:59 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..921 1..921 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:45 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..921 1..921 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 17:01:39 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..920 1..920 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:59 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..920 1..920 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:41:59 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..920 1..920 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:45 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
CG10301-RB 1..920 1..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:41 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23710158..23710450 1..293 100 -> Plus
3R 23710517..23710889 294..666 100 -> Plus
3R 23711005..23711258 667..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:41 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23710158..23710450 1..293 100 -> Plus
3R 23710517..23710889 294..666 100 -> Plus
3R 23711005..23711258 667..920 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:41 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23710158..23710450 1..293 100 -> Plus
3R 23710517..23710889 294..666 100 -> Plus
3R 23711005..23711258 667..920 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:41:59 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19535880..19536172 1..293 100 -> Plus
arm_3R 19536239..19536611 294..666 100 -> Plus
arm_3R 19536727..19536980 667..920 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:58 Download gff for RT07778.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23450989..23451281 1..293 100 -> Plus
3R 23451348..23451720 294..666 100 -> Plus
3R 23451836..23452089 667..920 100   Plus

RT07778.pep Sequence

Translation from 0 to 920

> RT07778.pep
MRRPLSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFL
IAFLRRCRYSLEETKRRIDRYFTHYNLFPEIMNNRCVTQRLLDINRMGVC
LYPDMPKGDSRSAMFIARFGHFDPNLYMLREIYHFSSMAMEVIALENDYA
SLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMYIINM
PKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEHIGKESLPEEYGGTNG
HLGECVAYMEDLLNSYRGYFEQDCNYGTIEELRHGEIATYEAEFGANGSF
RRLNWD*

RT07778.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16255-PA 306 GF16255-PA 1..306 1..306 1585 94.4 Plus
Dana\GF12489-PA 311 GF12489-PA 8..311 3..306 576 38.2 Plus
Dana\GF12490-PA 308 GF12490-PA 5..308 3..306 537 33.9 Plus
Dana\GF16256-PA 311 GF16256-PA 6..311 3..306 525 35.3 Plus
Dana\GF24440-PA 318 GF24440-PA 11..318 3..306 506 35.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11221-PA 306 GG11221-PA 1..306 1..306 1626 98.7 Plus
Dere\GG25270-PA 313 GG25270-PA 10..313 3..306 547 35.9 Plus
Dere\GG25272-PA 308 GG25272-PA 5..308 3..306 521 34.9 Plus
Dere\GG11223-PA 311 GG11223-PA 6..311 3..306 517 35.9 Plus
Dere\GG14765-PA 317 GG14765-PA 10..317 3..306 490 34 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17459-PA 306 GH17459-PA 1..306 1..306 1381 81.4 Plus
Dgri\GH22856-PA 316 GH22856-PA 13..316 3..306 541 36.5 Plus
Dgri\GH17460-PA 310 GH17460-PA 5..310 3..306 531 38.9 Plus
Dgri\GH22857-PA 310 GH22857-PA 7..310 3..306 497 32.9 Plus
Dgri\GH15438-PA 318 GH15438-PA 11..318 3..306 489 34.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG10301-PB 306 CG10301-PB 1..306 1..306 1638 100 Plus
CG12926-PA 313 CG12926-PA 10..313 3..306 540 36.5 Plus
CG30339-PA 308 CG30339-PA 5..308 3..306 529 35.2 Plus
CG10300-PA 311 CG10300-PA 6..311 3..306 496 35.3 Plus
CG33966-PA 310 CG33966-PA 5..310 3..306 492 35 Plus
CG33965-PA 317 CG33965-PA 10..314 3..303 474 34.4 Plus
CG33514-PA 311 CG33514-PA 6..311 3..306 463 32.7 Plus
CG31636-PB 313 CG31636-PB 5..313 3..306 463 34.6 Plus
CG31636-PA 313 CG31636-PA 5..313 3..306 463 34.6 Plus
CG1902-PC 312 CG1902-PC 5..312 3..306 394 31.4 Plus
CG1902-PA 312 CG1902-PA 5..312 3..306 394 31.4 Plus
CG2663-PC 308 CG2663-PC 22..308 19..306 275 27.6 Plus
CG2663-PA 308 CG2663-PA 22..308 19..306 275 27.6 Plus
CG10657-PA 334 CG10657-PA 31..274 5..248 224 27.6 Plus
Cralbp-PA 324 CG10546-PA 11..253 5..247 173 22.4 Plus
CG11550-PA 298 CG11550-PA 7..298 14..306 162 19 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:35:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22784-PA 306 GI22784-PA 1..306 1..306 1396 81.4 Plus
Dmoj\GI21233-PA 313 GI21233-PA 10..313 3..306 526 35.2 Plus
Dmoj\GI21234-PA 308 GI21234-PA 5..308 3..306 516 32.9 Plus
Dmoj\GI13038-PA 318 GI13038-PA 11..318 3..306 478 34.1 Plus
Dmoj\GI16717-PA 308 GI16717-PA 6..308 3..306 474 32.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13656-PA 306 GL13656-PA 1..306 1..306 1558 91.5 Plus
Dper\GL17330-PA 311 GL17330-PA 8..311 3..306 574 37.5 Plus
Dper\GL13658-PA 311 GL13658-PA 6..311 3..306 519 36.9 Plus
Dper\GL17331-PA 308 GL17331-PA 5..308 3..306 515 34.6 Plus
Dper\GL16161-PA 313 GL16161-PA 5..313 3..306 515 35.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10230-PA 306 GA10230-PA 1..306 1..306 1558 91.5 Plus
Dpse\GA11913-PA 311 GA11913-PA 8..311 3..306 575 37.5 Plus
Dpse\GA10229-PA 311 GA10229-PA 6..311 3..306 521 36.9 Plus
Dpse\GA28410-PA 313 GA28410-PA 5..313 3..306 518 35.9 Plus
Dpse\GA15770-PA 308 GA15770-PA 5..308 3..306 517 34.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26523-PA 306 GM26523-PA 1..306 1..306 1643 99.7 Plus
Dsec\GM20588-PA 313 GM20588-PA 10..313 3..306 546 36.2 Plus
Dsec\GM20589-PA 308 GM20589-PA 5..308 3..306 537 35.9 Plus
Dsec\GM26524-PA 311 GM26524-PA 6..311 3..306 493 34.6 Plus
Dsec\GM14385-PA 317 GM14385-PA 10..317 3..306 492 34.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21031-PA 306 GD21031-PA 1..306 1..306 1643 99.7 Plus
Dsim\GD10061-PA 308 GD10061-PA 5..308 3..306 530 35.5 Plus
Dsim\GD13840-PA 311 GD13840-PA 6..311 3..306 484 33.3 Plus
Dsim\GD22558-PA 313 GD22558-PA 5..313 3..306 475 34.6 Plus
Dsim\GD21032-PA 306 GD21032-PA 6..306 3..306 427 32 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22786-PA 306 GJ22786-PA 1..306 1..306 1425 83.7 Plus
Dvir\GJ20838-PA 316 GJ20838-PA 13..316 3..306 537 36.8 Plus
Dvir\GJ20839-PA 312 GJ20839-PA 9..312 3..306 527 33.6 Plus
Dvir\GJ22787-PA 310 GJ22787-PA 5..310 3..306 501 37.5 Plus
Dvir\GJ12134-PA 318 GJ12134-PA 11..318 3..306 488 34.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22398-PA 306 GK22398-PA 1..306 1..306 1535 90.5 Plus
Dwil\GK15622-PA 313 GK15622-PA 10..313 3..306 559 36.8 Plus
Dwil\GK15623-PA 309 GK15623-PA 6..309 3..306 529 34.2 Plus
Dwil\GK22399-PA 312 GK22399-PA 7..312 3..306 517 37.3 Plus
Dwil\GK21135-PA 310 GK21135-PA 5..310 3..306 485 36.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10387-PA 306 GE10387-PA 1..306 1..306 1636 98.7 Plus
Dyak\GE22148-PA 313 GE22148-PA 10..313 3..306 551 35.9 Plus
Dyak\GE22159-PA 308 GE22159-PA 5..308 3..306 530 34.9 Plus
Dyak\GE10388-PA 312 GE10388-PA 7..312 3..306 510 35.9 Plus
Dyak\GE21128-PA 317 GE21128-PA 10..317 3..306 491 34.1 Plus

RT07778.hyp Sequence

Translation from 1 to 918

> RT07778.hyp
MRRPLSPTLAKLAEQEVNETPDRIQQDIIILRVWIRQQPHLRARTDVDFL
IAFLRRCRYSLEETKRRIDRYFTHYNLFPEIMNNRCVTQRLLDINRMGVC
LYPDMPKGDSRSAMFIARFGHFDPNLYMLREIYHFSSMAMEVIALENDYA
SLAGICEIIDLEGVNSDKMRRFDRVLFRKWWNWLYNCSPLKVKEMYIINM
PKDIQGTVMFLYNVLSMQVNYPIRVLKNSEELIEHIGKESLPEEYGGTNG
HLGECVAYMEDLLNSYRGYFEQDCNYGTIEELRHGEIATYEAEFGANGSF
RRLNWD

RT07778.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10301-PB 306 CG10301-PB 1..306 1..306 1638 100 Plus
CG12926-PA 313 CG12926-PA 10..313 3..306 540 36.5 Plus
CG30339-PA 308 CG30339-PA 5..308 3..306 529 35.2 Plus
CG10300-PA 311 CG10300-PA 6..311 3..306 496 35.3 Plus
CG33966-PA 310 CG33966-PA 5..310 3..306 492 35 Plus