Clone RT07838 Report

Search the DGRC for RT07838

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:78
Well:38
Vector:pCR2.1
Associated Gene/TranscriptCG13869-RA
Protein status:RT07838.pep: gold
Sequenced Size:648

Clone Sequence Records

RT07838.complete Sequence

648 bp assembled on 2010-04-26

GenBank Submission: BT124806.1

> RT07838.complete
ATGAACCTTTTGGCGAAAATCATACTGTTCCTTTTCACTCTCGAGGCTGT
GAGTGCTTTAGAGGCCAATCTCACTTCGTGGCGACATCACAGAAGGCAAA
AGCGGTTCCTGATTTATCAGAATGGCGGTGTAATCAAGTTCGTTTCGGGA
TGTGCATTTCCGGCTCCGTTTATGGAGAAAAAGGCATGGCGCCAGTTGGT
TTGGCTGATGAACTTTCACTATCAGTTCAATGAGCCGCAAACTCCAATCT
ACTGGTGGAAACTTTGGGATGGCTCCCGAAATCTCAAGGGACCATTGACC
CAACCTGCTCCTCCATCCGTTCCAGCTCGTCTTTTGGTGGACGAGCCTCA
ACTTCTGCTATTCAAGTTCGCCGAGGCCTATATGAACCAGTTGGGTCAAA
ATGGTAGTGCCTGTCTGGATCGTCTGATCTGCGAGAATGGTCAGGTGGAT
GAGCATAGTGGACTCTACGCCCAACTGCTCCACAGGTTGTTAAGACCTCA
TCAAACGCTGGACGTGAGATATTTGGATGCCTACAGGATGGGTCGCCATG
GCGTTGACTGCCGAAATGCCTTTCCAGAGGCCCATCATTGCATTTTGGAT
GACTACCTACACCTCCATGAGCGAGGACCGAAACAGAGTTTTCTTTAG

RT07838.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG13869-RA 753 CG13869-RA 106..753 1..648 3240 100 Plus
CG13869.a 995 CG13869.a 348..995 1..648 3240 100 Plus
CG11099-RA 2354 CG11099-RA 1924..2281 494..137 1790 100 Minus
CG11099-RA 2354 CG11099-RA 1716..1871 648..493 780 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:50:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 16125838..16126195 494..137 1685 98 Minus
chr2R 21145070 chr2R 16125630..16125785 648..493 780 100 Minus
chr2R 21145070 chr2R 16126257..16126383 138..12 575 96.9 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20238778..20239135 494..137 1790 100 Minus
2R 25286936 2R 20238570..20238725 648..493 780 100 Minus
2R 25286936 2R 20239197..20239323 138..12 635 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 20239977..20240334 494..137 1790 100 Minus
2R 25260384 2R 20239769..20239924 648..493 780 100 Minus
2R 25260384 2R 20240396..20240522 138..12 635 100 Minus
Blast to na_te.dros performed on 2019-03-15 18:49:58 has no hits.

RT07838.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:51:00 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 16125630..16125783 495..648 100 <- Minus
chr2R 16125838..16126193 139..494 98 <- Minus
chr2R 16126257..16126383 12..138 96   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 16:56:15 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:49 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:25 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:35 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 16:56:15 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:48 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 1..648 1..648 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:25 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 31..678 1..648 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:35 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
CG13869-RA 31..678 1..648 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:00 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20238778..20239133 139..494 100 <- Minus
2R 20239197..20239323 12..138 100   Minus
2R 20238570..20238723 495..648 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:00 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20238778..20239133 139..494 100 <- Minus
2R 20239197..20239323 12..138 100   Minus
2R 20238570..20238723 495..648 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:51:00 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20238778..20239133 139..494 100 <- Minus
2R 20239197..20239323 12..138 100   Minus
2R 20238570..20238723 495..648 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:25 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16126283..16126638 139..494 100 <- Minus
arm_2R 16126075..16126228 495..648 100 <- Minus
arm_2R 16126702..16126828 12..138 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:52 Download gff for RT07838.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20239977..20240332 139..494 100 <- Minus
2R 20240396..20240522 12..138 100   Minus
2R 20239769..20239922 495..648 100 <- Minus

RT07838.pep Sequence

Translation from 0 to 647

> RT07838.pep
MNLLAKIILFLFTLEAVSALEANLTSWRHHRRQKRFLIYQNGGVIKFVSG
CAFPAPFMEKKAWRQLVWLMNFHYQFNEPQTPIYWWKLWDGSRNLKGPLT
QPAPPSVPARLLVDEPQLLLFKFAEAYMNQLGQNGSACLDRLICENGQVD
EHSGLYAQLLHRLLRPHQTLDVRYLDAYRMGRHGVDCRNAFPEAHHCILD
DYLHLHERGPKQSFL*

RT07838.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13158-PA 219 GF13158-PA 1..217 1..215 939 77.9 Plus
Dana\GF24785-PA 215 GF24785-PA 1..209 1..202 253 31.6 Plus
Dana\GF25015-PA 221 GF25015-PA 16..202 12..191 247 33.3 Plus
Dana\GF20718-PA 227 GF20718-PA 49..209 32..197 213 31 Plus
Dana\GF20749-PA 219 GF20749-PA 42..200 32..191 177 28.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20881-PA 253 GG20881-PA 39..253 1..215 1084 91.2 Plus
Dere\GG14990-PA 219 GG14990-PA 1..213 1..202 252 30.1 Plus
Dere\GG14410-PA 219 GG14410-PA 25..196 23..187 223 33.7 Plus
Dere\GG11291-PA 221 GG11291-PA 15..200 8..191 211 29.3 Plus
Dere\GG12349-PA 237 GG12349-PA 48..221 21..195 203 29.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:35:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14932-PA 202 GH14932-PA 14..183 23..191 244 35.2 Plus
Dgri\GH16569-PA 221 GH16569-PA 7..198 8..187 227 32.6 Plus
Dgri\GH18793-PA 238 GH18793-PA 60..235 32..207 189 26.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13869-PA 215 CG13869-PA 1..215 1..215 1177 100 Plus
CG14829-PB 219 CG14829-PB 31..213 23..202 238 33.3 Plus
CG14826-PC 219 CG14826-PC 25..208 23..196 224 32.6 Plus
CG14826-PA 219 CG14826-PA 25..208 23..196 224 32.6 Plus
CG33342-PB 219 CG33342-PB 15..202 8..193 198 29.5 Plus
CG17784-PA 237 CG17784-PA 48..221 21..195 190 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18530-PA 228 GI18530-PA 1..228 1..215 676 57.5 Plus
Dmoj\GI13859-PA 221 GI13859-PA 11..202 12..191 212 31.8 Plus
Dmoj\GI13860-PA 221 GI13860-PA 11..202 12..191 212 31.8 Plus
Dmoj\GI11452-PA 217 GI11452-PA 23..198 17..191 211 33 Plus
Dmoj\GI11450-PA 216 GI11450-PA 23..197 17..191 195 34.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10163-PA 209 GL10163-PA 1..209 1..215 858 74.4 Plus
Dper\GL24903-PA 216 GL24903-PA 28..199 23..193 246 33.1 Plus
Dper\GL21985-PA 226 GL21985-PA 34..210 21..194 210 31.7 Plus
Dper\GL21862-PA 227 GL21862-PA 52..224 34..207 205 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12585-PA 209 GA12585-PA 1..209 1..215 867 74.9 Plus
Dpse\GA13279-PA 216 GA13279-PA 28..199 23..193 244 33.1 Plus
Dpse\GA13277-PA 224 GA13277-PA 13..201 9..187 238 34.4 Plus
Dpse\GA14665-PA 228 GA14665-PA 28..212 13..194 212 30.9 Plus
Dpse\GA26433-PA 227 GA26433-PA 52..224 34..207 201 29.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19804-PA 225 GM19804-PA 15..225 5..215 1105 95.7 Plus
Dsec\GM13786-PA 219 GM13786-PA 31..213 23..202 248 32.8 Plus
Dsec\GM14825-PA 219 GM14825-PA 9..196 7..187 234 32 Plus
Dsec\GM26597-PA 219 GM26597-PA 15..202 8..193 218 30.1 Plus
Dsec\GM23489-PA 237 GM23489-PA 48..221 21..195 195 29.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25297-PA 217 GD25297-PA 7..217 5..215 1106 96.2 Plus
Dsim\GD13083-PA 219 GD13083-PA 31..213 23..202 248 32.8 Plus
Dsim\GD21098-PA 219 GD21098-PA 15..205 8..196 216 29.6 Plus
Dsim\GD18295-PA 237 GD18295-PA 48..221 21..195 207 30.6 Plus
Dsim\GD13999-PA 148 GD13999-PA 1..125 70..187 149 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21396-PA 220 GJ21396-PA 1..220 1..215 756 65.6 Plus
Dvir\GJ11720-PA 246 GJ11720-PA 27..224 5..191 241 33.2 Plus
Dvir\GJ13647-PA 217 GJ13647-PA 29..200 23..193 232 33.1 Plus
Dvir\GJ23411-PA 239 GJ23411-PA 61..225 32..196 200 31.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15682-PA 137 GK15682-PA 1..136 70..204 548 71.7 Plus
Dwil\GK13171-PA 221 GK13171-PA 14..198 10..187 243 32.5 Plus
Dwil\GK25529-PA 222 GK25529-PA 10..216 6..203 240 32.4 Plus
Dwil\GK22827-PA 224 GK22827-PA 18..223 3..210 207 28.6 Plus
Dwil\GK19121-PA 160 GK19121-PA 1..143 47..193 155 29.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:35:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13820-PA 215 GE13820-PA 12..215 12..215 1040 92.2 Plus
Dyak\GE20436-PA 219 GE20436-PA 1..213 1..202 262 32.4 Plus
Dyak\GE21599-PA 219 GE21599-PA 25..196 23..187 219 33.3 Plus
Dyak\GE10802-PA 237 GE10802-PA 48..221 21..195 205 28.7 Plus

RT07838.hyp Sequence

Translation from 12 to 647

> RT07838.hyp
AKIILFLFTLEAVSALEANLTSWRHHRRQKRFLIYQNGGVIKFVSGCAFP
APFMEKKAWRQLVWLMNFHYQFNEPQTPIYWWKLWDGSRNLKGPLTQPAP
PSVPARLLVDEPQLLLFKFAEAYMNQLGQNGSACLDRLICENGQVDEHSG
LYAQLLHRLLRPHQTLDVRYLDAYRMGRHGVDCRNAFPEAHHCILDDYLH
LHERGPKQSFL*

RT07838.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG13869-PA 215 CG13869-PA 5..215 1..211 1158 100 Plus
CG14829-PB 219 CG14829-PB 31..213 19..198 238 33.3 Plus
CG14826-PC 219 CG14826-PC 25..208 19..192 224 32.6 Plus
CG14826-PA 219 CG14826-PA 25..208 19..192 224 32.6 Plus
CG33342-PB 219 CG33342-PB 15..202 4..189 198 29.5 Plus