Clone RT07854 Report

Search the DGRC for RT07854

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:78
Well:54
Vector:pCR2.1
Associated Gene/TranscriptCG13996-RA
Protein status:RT07854.pep: gold
Sequenced Size:771

Clone Sequence Records

RT07854.complete Sequence

771 bp assembled on 2010-04-26

GenBank Submission: BT124800.1

> RT07854.complete
ATGGAGTCGTTCTCAGCGTCCAGGTGCTCCACCATACCGTCACCACTGCC
GCACAGTGCCAGTGGCATGGACAGTCCGGATATCTGTGAGCCGCCGCAGG
ATGAGCAGGAGTTCTGCTTTCGCTATCCCAGCTACATGTTTCCGGACGTG
GAGTACGACAAGGAGGATGTGCCGCTACCCTTCAAGGCCTCGCCGGACTC
GCTCTTCAATCTCTGCGCCGCCGTCGTGGATTCCCAAGCCCGCACTGAGG
TCTTCAAGTGGAGCATCAACGATGTGACCGACTGGCTGCGCAACTTTGGT
TATCCCGAGTACGAGCAAACTTTTCGGGAGAACTACATTGATGGACACAA
GCTGCTGAATCTGGACGCAGTTGCTCTGGTTGCGCTCAACGTTCGCAACT
TCGAGCACATCCGCCACCTGGGCCGCGGCATACGAGCGCTTTACAGGAAG
GAGCTGCAAACGGCGACGGAGACCAAGCAGCAGAGTGAGGTCTATAAGAC
ATTCCGGGCCCGCACTGGCCGAAGGTACGAGGGATTGCGGGAGACGGAGC
TACTGGGCCGCATGCACATGATTCGCTCCGTTTTCCGCGACGTCAACGAC
TGGGATCTGATGGAGCTGCACATGTCCAGGGCGCCGGTGAGGCGGTATCG
CGAGATCGTCGCTGGCTCCAGACGCTACAACCTCTATGGCCCATCGACAG
CGCGCCGGGAACCCATCATTACGGACGATGTGGATGCCACACCGTGGTAC
AACTTCGAGGATTGCTACTGA

RT07854.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG13996-RA 932 CG13996-RA 99..869 1..771 3855 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6020266..6020722 314..770 2285 100 Plus
chr2L 23010047 chr2L 6019901..6020215 1..315 1575 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:08:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6021215..6021672 314..771 2290 100 Plus
2L 23513712 2L 6020850..6021164 1..315 1575 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6021215..6021672 314..771 2290 100 Plus
2L 23513712 2L 6020850..6021164 1..315 1575 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:08:32 has no hits.

RT07854.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:09:32 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6019901..6020215 1..315 100 -> Plus
chr2L 6020268..6020722 316..770 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 15:43:17 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:34 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:41:52 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 1..771 1..771 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:26 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 1..771 1..771 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 15:43:17 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:34 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 1..770 1..770 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:41:52 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 16..785 1..770 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:26 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
CG13996-RA 16..785 1..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:32 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6020850..6021164 1..315 100 -> Plus
2L 6021217..6021671 316..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:32 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6020850..6021164 1..315 100 -> Plus
2L 6021217..6021671 316..770 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:09:32 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6020850..6021164 1..315 100 -> Plus
2L 6021217..6021671 316..770 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:41:52 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6020850..6021164 1..315 100 -> Plus
arm_2L 6021217..6021671 316..770 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:44 Download gff for RT07854.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6020850..6021164 1..315 100 -> Plus
2L 6021217..6021671 316..770 100   Plus

RT07854.pep Sequence

Translation from 0 to 770

> RT07854.pep
MESFSASRCSTIPSPLPHSASGMDSPDICEPPQDEQEFCFRYPSYMFPDV
EYDKEDVPLPFKASPDSLFNLCAAVVDSQARTEVFKWSINDVTDWLRNFG
YPEYEQTFRENYIDGHKLLNLDAVALVALNVRNFEHIRHLGRGIRALYRK
ELQTATETKQQSEVYKTFRARTGRRYEGLRETELLGRMHMIRSVFRDVND
WDLMELHMSRAPVRRYREIVAGSRRYNLYGPSTARREPIITDDVDATPWY
NFEDCY*

RT07854.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15598-PA 257 GF15598-PA 11..257 12..256 1168 86.6 Plus
Dana\GF23547-PA 351 GF23547-PA 33..236 40..238 359 35.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:33:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23918-PA 243 GG23918-PA 1..229 1..229 1214 97.8 Plus
Dere\GG25026-PA 350 GG25026-PA 43..236 51..239 400 38.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:33:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11021-PA 257 GH11021-PA 22..257 23..256 1045 79.7 Plus
Dgri\GH11189-PA 377 GH11189-PA 31..240 40..244 303 32.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13996-PA 256 CG13996-PA 1..256 1..256 1376 100 Plus
CG15625-PA 349 CG15625-PA 43..242 51..245 389 37 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:33:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17540-PA 267 GI17540-PA 18..267 9..256 1060 77.2 Plus
Dmoj\GI18110-PA 346 GI18110-PA 28..216 36..219 342 36.5 Plus
Dmoj\GI10165-PA 341 GI10165-PA 39..223 50..229 339 39.5 Plus
Dmoj\GI22590-PA 347 GI22590-PA 43..234 51..240 313 34.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19050-PA 251 GL19050-PA 23..251 28..256 1108 86 Plus
Dper\GL18641-PA 345 GL18641-PA 30..229 40..234 370 38.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:33:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12685-PA 251 GA12685-PA 23..251 28..256 1108 86 Plus
Dpse\GA13855-PA 345 GA13855-PA 30..229 40..234 367 38.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:33:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18590-PA 260 GM18590-PA 1..256 1..256 1376 99.6 Plus
Dsec\GM18499-PA 349 GM18499-PA 43..233 51..236 376 37.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23378-PA 256 GD23378-PA 1..256 1..256 1375 99.6 Plus
Dsim\GD23307-PA 349 GD23307-PA 43..233 51..236 378 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:33:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15442-PA 263 GJ15442-PA 27..263 22..256 1039 78.1 Plus
Dvir\GJ10867-PA 347 GJ10867-PA 28..222 40..229 350 38.5 Plus
Dvir\GJ16297-PA 354 GJ16297-PA 43..227 50..229 326 37.8 Plus
Dvir\GJ10311-PA 352 GJ10311-PA 43..226 51..229 314 36.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:33:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14714-PA 237 GK14714-PA 1..237 23..256 1078 81 Plus
Dwil\GK24470-PA 348 GK24470-PA 42..235 51..239 314 35.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:33:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25822-PA 256 GE25822-PA 1..256 1..256 1357 97.3 Plus
Dyak\GE18315-PA 349 GE18315-PA 42..234 51..238 356 39.4 Plus

RT07854.hyp Sequence

Translation from 1 to 768

> RT07854.hyp
MESFSASRCSTIPSPLPHSASGMDSPDICEPPQDEQEFCFRYPSYMFPDV
EYDKEDVPLPFKASPDSLFNLCAAVVDSQARTEVFKWSINDVTDWLRNFG
YPEYEQTFRENYIDGHKLLNLDAVALVALNVRNFEHIRHLGRGIRALYRK
ELQTATETKQQSEVYKTFRARTGRRYEGLRETELLGRMHMIRSVFRDVND
WDLMELHMSRAPVRRYREIVAGSRRYNLYGPSTARREPIITDDVDATPWY
NFEDCY

RT07854.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG13996-PA 256 CG13996-PA 1..256 1..256 1376 100 Plus
CG15625-PA 349 CG15625-PA 43..242 51..245 389 37 Plus