BDGP Sequence Production Resources |
Search the DGRC for RT07901
Library: | RT |
Tissue Source: | D melanogaster pooled RNA |
Created by: | |
Date Registered: | 2006-04-14 |
Comments: | TA cloning vector from Invitrogen |
Original Plate Number: | 79 |
Well: | 1 |
Vector: | pCR2.1 |
Associated Gene/Transcript | CG13230-RA |
Protein status: | RT07901.pep: gold |
Sequenced Size: | 219 |
219 bp assembled on 2010-04-26
GenBank Submission: BT124803.1
> RT07901.complete ATGTCGAGAATCCTTGTCGCCGCCATCGCCTTCGTTACCATCTGTCTGGT CCTTGTCAGCGCCGCCCCCGCTCCCGCCCCGCCCACACAGATCCTGGATG CCCGGACGGCCATCCAGAAGATAATCGACGCTTACAATCGGATTCCGGGT CCTTCAGTTGTTCACCCCTGGGAGGTGGCCACTTTGATTGACCCGAACAC CTTTGTGGCCCAATTCTGA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13230-RA | 532 | CG13230-RA | 123..341 | 1..219 | 1095 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7042396..7042522 | 1..127 | 100 | -> | Plus |
chr2R | 7042604..7042694 | 128..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 1..218 | 1..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 1..218 | 1..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 1..219 | 1..219 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 1..219 | 1..219 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 1..218 | 1..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 1..218 | 1..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 33..250 | 1..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13230-RA | 33..250 | 1..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11154928..11155054 | 1..127 | 100 | -> | Plus |
2R | 11155135..11155225 | 128..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11154928..11155054 | 1..127 | 100 | -> | Plus |
2R | 11155135..11155225 | 128..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11154928..11155054 | 1..127 | 100 | -> | Plus |
2R | 11155135..11155225 | 128..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7042433..7042559 | 1..127 | 100 | -> | Plus |
arm_2R | 7042640..7042730 | 128..218 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11156127..11156253 | 1..127 | 100 | -> | Plus |
2R | 11156334..11156424 | 128..218 | 100 | Plus |
Translation from 0 to 218
> RT07901.pep MSRILVAAIAFVTICLVLVSAAPAPAPPTQILDARTAIQKIIDAYNRIPG PSVVHPWEVATLIDPNTFVAQF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12525-PA | 69 | GF12525-PA | 1..69 | 1..72 | 262 | 73.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20166-PA | 72 | GG20166-PA | 1..72 | 1..72 | 293 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21289-PA | 72 | GH21289-PA | 1..65 | 1..68 | 150 | 49.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13230-PA | 72 | CG13230-PA | 1..72 | 1..72 | 363 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19777-PA | 70 | GI19777-PA | 1..64 | 1..69 | 212 | 65.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19946-PA | 68 | GL19946-PA | 1..68 | 1..72 | 239 | 66.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12141-PA | 70 | GA12141-PA | 1..70 | 1..72 | 211 | 69.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10770-PA | 70 | GD10770-PA | 1..70 | 1..72 | 332 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17664-PA | 69 | GJ17664-PA | 1..65 | 1..69 | 208 | 62.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20952-PA | 73 | GK20952-PA | 31..73 | 30..72 | 202 | 86 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12856-PA | 72 | GE12856-PA | 1..72 | 1..72 | 295 | 94.4 | Plus |
Translation from 1 to 216
> RT07901.hyp MSRILVAAIAFVTICLVLVSAAPAPAPPTQILDARTAIQKIIDAYNRIPG PSVVHPWEVATLIDPNTFVAQF
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13230-PA | 72 | CG13230-PA | 1..72 | 1..72 | 363 | 100 | Plus |