Clone RT07901 Report

Search the DGRC for RT07901

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:79
Well:1
Vector:pCR2.1
Associated Gene/TranscriptCG13230-RA
Protein status:RT07901.pep: gold
Sequenced Size:219

Clone Sequence Records

RT07901.complete Sequence

219 bp assembled on 2010-04-26

GenBank Submission: BT124803.1

> RT07901.complete
ATGTCGAGAATCCTTGTCGCCGCCATCGCCTTCGTTACCATCTGTCTGGT
CCTTGTCAGCGCCGCCCCCGCTCCCGCCCCGCCCACACAGATCCTGGATG
CCCGGACGGCCATCCAGAAGATAATCGACGCTTACAATCGGATTCCGGGT
CCTTCAGTTGTTCACCCCTGGGAGGTGGCCACTTTGATTGACCCGAACAC
CTTTGTGGCCCAATTCTGA

RT07901.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG13230-RA 532 CG13230-RA 123..341 1..219 1095 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7042396..7042522 1..127 635 100 Plus
chr2R 21145070 chr2R 7042603..7042694 127..218 460 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11154928..11155054 1..127 635 100 Plus
2R 25286936 2R 11155134..11155226 127..219 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11156127..11156253 1..127 635 100 Plus
2R 25260384 2R 11156333..11156425 127..219 465 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:49:56 has no hits.

RT07901.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:50:59 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7042396..7042522 1..127 100 -> Plus
chr2R 7042604..7042694 128..218 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 16:35:19 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 1..218 1..218 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:30:41 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 1..218 1..218 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:21 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 1..219 1..219 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:32 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 1..219 1..219 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 16:35:18 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 1..218 1..218 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:30:41 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 1..218 1..218 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:21 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 33..250 1..218 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:32 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
CG13230-RA 33..250 1..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:59 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11154928..11155054 1..127 100 -> Plus
2R 11155135..11155225 128..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:59 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11154928..11155054 1..127 100 -> Plus
2R 11155135..11155225 128..218 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:59 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11154928..11155054 1..127 100 -> Plus
2R 11155135..11155225 128..218 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:21 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7042433..7042559 1..127 100 -> Plus
arm_2R 7042640..7042730 128..218 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:48 Download gff for RT07901.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11156127..11156253 1..127 100 -> Plus
2R 11156334..11156424 128..218 100   Plus

RT07901.pep Sequence

Translation from 0 to 218

> RT07901.pep
MSRILVAAIAFVTICLVLVSAAPAPAPPTQILDARTAIQKIIDAYNRIPG
PSVVHPWEVATLIDPNTFVAQF*

RT07901.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12525-PA 69 GF12525-PA 1..69 1..72 262 73.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20166-PA 72 GG20166-PA 1..72 1..72 293 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21289-PA 72 GH21289-PA 1..65 1..68 150 49.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13230-PA 72 CG13230-PA 1..72 1..72 363 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19777-PA 70 GI19777-PA 1..64 1..69 212 65.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19946-PA 68 GL19946-PA 1..68 1..72 239 66.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12141-PA 70 GA12141-PA 1..70 1..72 211 69.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10770-PA 70 GD10770-PA 1..70 1..72 332 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17664-PA 69 GJ17664-PA 1..65 1..69 208 62.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20952-PA 73 GK20952-PA 31..73 30..72 202 86 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12856-PA 72 GE12856-PA 1..72 1..72 295 94.4 Plus

RT07901.hyp Sequence

Translation from 1 to 216

> RT07901.hyp
MSRILVAAIAFVTICLVLVSAAPAPAPPTQILDARTAIQKIIDAYNRIPG
PSVVHPWEVATLIDPNTFVAQF

RT07901.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG13230-PA 72 CG13230-PA 1..72 1..72 363 100 Plus