Clone RT07903 Report

Search the DGRC for RT07903

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:79
Well:3
Vector:pCR2.1
Associated Gene/TranscriptCG6244-RA
Protein status:RT07903.pep: gold
Sequenced Size:249

Clone Sequence Records

RT07903.complete Sequence

249 bp assembled on 2010-04-26

GenBank Submission: BT124811.1

> RT07903.complete
ATGGGTCGTCGCAAGTCCAAACGCAAAGGAGCCCCAAGAAAGAAAAATAT
TCAGCCGCTGCCCATTCTTTTCGATTGTCCATTCTGCAATCACAAGCAGT
CATGTGAAGCGAAACTAGATAAGGCGAAAAAAATAGGAAGAATTACCTGT
ACCGTGTGCCAAGAATTTTTTCAAACACATATAAACTATCTCACGGAGGC
AATTGATGTGTTCAACGATTGGATTGATGCTTGCGAGGAGGAGAACTAA

RT07903.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-RA 730 CG6244-RA 258..506 1..249 1245 100 Plus
nc_12783.a 262 nc_12783.a 24..139 116..1 580 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:25:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15798411..15798541 117..247 655 100 Plus
chr3L 24539361 chr3L 15798242..15798357 1..116 580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15808587..15808719 117..249 665 100 Plus
3L 28110227 3L 15808418..15808533 1..116 580 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15801687..15801819 117..249 665 100 Plus
3L 28103327 3L 15801518..15801633 1..116 580 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:25:58 has no hits.

RT07903.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:27:00 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15798242..15798357 1..116 100 -> Plus
chr3L 15798411..15798543 117..249 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 17:01:41 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..247 1..247 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:40 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:41:43 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:07:47 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 17:01:40 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..247 1..247 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:40 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 1..249 1..249 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:41:43 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 97..345 1..249 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:07:47 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
CG6244-RA 97..345 1..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:00 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15808418..15808533 1..116 100 -> Plus
3L 15808587..15808719 117..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:00 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15808418..15808533 1..116 100 -> Plus
3L 15808587..15808719 117..249 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:27:00 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15808418..15808533 1..116 100 -> Plus
3L 15808587..15808719 117..249 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:41:43 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15801687..15801819 117..249 100   Plus
arm_3L 15801518..15801633 1..116 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:00 Download gff for RT07903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15801518..15801633 1..116 100 -> Plus
3L 15801687..15801819 117..249 100   Plus

RT07903.pep Sequence

Translation from 0 to 248

> RT07903.pep
MGRRKSKRKGAPRKKNIQPLPILFDCPFCNHKQSCEAKLDKAKKIGRITC
TVCQEFFQTHINYLTEAIDVFNDWIDACEEEN*

RT07903.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:36:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20068-PA 82 GF20068-PA 1..82 1..82 336 72 Plus
Dana\GF19993-PA 82 GF19993-PA 1..82 1..82 293 63.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15927-PA 82 GG15927-PA 1..82 1..82 373 80.5 Plus
Dere\GG16332-PA 82 GG16332-PA 1..82 1..82 293 63.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18042-PA 82 GH18042-PA 1..82 1..82 293 63.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-PA 82 CG6244-PA 1..82 1..82 454 100 Plus
CG40228-PD 82 CG40228-PD 1..82 1..82 306 63.4 Plus
CG40228-PC 82 CG40228-PC 1..82 1..82 306 63.4 Plus
CG40228-PE 77 CG40228-PE 1..77 1..82 269 59.8 Plus
CG40228-PF 43 CG40228-PF 1..34 1..34 133 67.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23965-PA 82 GI23965-PA 1..82 1..82 293 63.4 Plus
Dmoj\GI11689-PA 82 GI11689-PA 1..82 1..82 288 65.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21968-PA 82 GL21968-PA 1..82 1..82 293 63.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17880-PA 82 GA17880-PA 1..82 1..82 293 63.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:36:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19294-PA 82 GM19294-PA 1..82 1..82 294 63.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14572-PA 82 GD14572-PA 1..82 1..82 419 93.9 Plus
Dsim\GD25376-PA 82 GD25376-PA 1..82 1..82 294 63.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22512-PA 82 GJ22512-PA 1..82 1..82 293 63.4 Plus
Dvir\GJ11363-PA 82 GJ11363-PA 1..82 1..82 291 64.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19168-PA 82 GK19168-PA 1..82 1..82 291 63.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:36:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22275-PA 82 GE22275-PA 1..82 1..82 384 80.5 Plus
Dyak\GE22277-PA 82 GE22277-PA 1..82 1..82 384 80.5 Plus
Dyak\GE19761-PA 82 GE19761-PA 1..82 1..82 296 64.6 Plus

RT07903.hyp Sequence

Translation from 1 to 246

> RT07903.hyp
MGRRKSKRKGAPRKKNIQPLPILFDCPFCNHKQSCEAKLDKAKKIGRITC
TVCQEFFQTHINYLTEAIDVFNDWIDACEEEN

RT07903.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:48:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG6244-PA 82 CG6244-PA 1..82 1..82 454 100 Plus
CG40228-PD 82 CG40228-PD 1..82 1..82 306 63.4 Plus
CG40228-PC 82 CG40228-PC 1..82 1..82 306 63.4 Plus
CG40228-PE 77 CG40228-PE 1..77 1..82 269 59.8 Plus
CG40228-PF 43 CG40228-PF 1..34 1..34 133 67.6 Plus