BDGP Sequence Production Resources |
Search the DGRC for RT07907
Library: | RT |
Tissue Source: | D melanogaster pooled RNA |
Created by: | |
Date Registered: | 2006-04-14 |
Comments: | TA cloning vector from Invitrogen |
Original Plate Number: | 79 |
Well: | 7 |
Vector: | pCR2.1 |
Associated Gene/Transcript | CG34223-RA |
Protein status: | RT07907.pep: gold |
Sequenced Size: | 285 |
285 bp assembled on 2010-04-26
GenBank Submission: BT124826.1
> RT07907.complete ATGTTCCGCTTGCTGCTGCTGTGGATCACTGTGGGGCTGGTGGCAGCTCT GGATGAGCGGGAATTCGATCCGCAGGTGGCACCACCTCAAAGTTCAGTTC CAAAACCCTTTCAGCTGTGGCGAAGTTTTGCGAGTCATGTGCGTCTTGTC TTTAGTCGTCTTCAACCTAAGTCACCAACTCCGCCCACCGTTAGGACCAA AACGGGTATAACTACCACCACTCCCGAACCTGAACTGCAGTTCTATGGAG CTCTGAATCCCATATACCAAACAGGGAACTTTTAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34223-RA | 285 | CG34223-RA | 1..285 | 1..285 | 1425 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 7123326..7123422 | 1..97 | 98 | -> | Plus |
chr2R | 7123483..7123670 | 98..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..283 | 1..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..285 | 1..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..285 | 1..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..285 | 1..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..283 | 1..283 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..285 | 1..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..285 | 1..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG34223-RA | 1..285 | 1..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11235860..11235956 | 1..97 | 100 | -> | Plus |
2R | 11236017..11236204 | 98..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11235860..11235956 | 1..97 | 100 | -> | Plus |
2R | 11236017..11236204 | 98..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11235860..11235956 | 1..97 | 100 | -> | Plus |
2R | 11236017..11236204 | 98..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 7123365..7123461 | 1..97 | 100 | -> | Plus |
arm_2R | 7123522..7123709 | 98..285 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 11237059..11237155 | 1..97 | 100 | -> | Plus |
2R | 11237216..11237403 | 98..285 | 100 | Plus |
Translation from 0 to 284
> RT07907.pep MFRLLLLWITVGLVAALDEREFDPQVAPPQSSVPKPFQLWRSFASHVRLV FSRLQPKSPTPPTVRTKTGITTTTPEPELQFYGALNPIYQTGNF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12531-PA | 95 | GF12531-PA | 1..95 | 1..94 | 295 | 75 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20173-PA | 94 | GG20173-PA | 1..94 | 1..94 | 435 | 88.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH19939-PA | 104 | GH19939-PA | 10..104 | 5..94 | 171 | 44.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34223-PA | 94 | CG34223-PA | 1..94 | 1..94 | 496 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19896-PA | 101 | GI19896-PA | 19..101 | 15..94 | 151 | 41.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17713-PA | 102 | GL17713-PA | 10..102 | 7..94 | 231 | 53.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA24885-PA | 102 | GA24885-PA | 10..102 | 7..94 | 220 | 51 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21262-PA | 94 | GM21262-PA | 1..94 | 1..94 | 468 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10776-PA | 94 | GD10776-PA | 1..94 | 1..94 | 471 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15065-PA | 94 | GJ15065-PA | 15..94 | 14..94 | 155 | 45.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12863-PA | 94 | GE12863-PA | 1..94 | 1..94 | 389 | 89.4 | Plus |
Translation from 1 to 282
> RT07907.hyp MFRLLLLWITVGLVAALDEREFDPQVAPPQSSVPKPFQLWRSFASHVRLV FSRLQPKSPTPPTVRTKTGITTTTPEPELQFYGALNPIYQTGNF
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG34223-PA | 94 | CG34223-PA | 1..94 | 1..94 | 496 | 100 | Plus |