Clone RT07907 Report

Search the DGRC for RT07907

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:79
Well:7
Vector:pCR2.1
Associated Gene/TranscriptCG34223-RA
Protein status:RT07907.pep: gold
Sequenced Size:285

Clone Sequence Records

RT07907.complete Sequence

285 bp assembled on 2010-04-26

GenBank Submission: BT124826.1

> RT07907.complete
ATGTTCCGCTTGCTGCTGCTGTGGATCACTGTGGGGCTGGTGGCAGCTCT
GGATGAGCGGGAATTCGATCCGCAGGTGGCACCACCTCAAAGTTCAGTTC
CAAAACCCTTTCAGCTGTGGCGAAGTTTTGCGAGTCATGTGCGTCTTGTC
TTTAGTCGTCTTCAACCTAAGTCACCAACTCCGCCCACCGTTAGGACCAA
AACGGGTATAACTACCACCACTCCCGAACCTGAACTGCAGTTCTATGGAG
CTCTGAATCCCATATACCAAACAGGGAACTTTTAA

RT07907.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-RA 285 CG34223-RA 1..285 1..285 1425 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7123480..7123668 95..283 945 100 Plus
chr2R 21145070 chr2R 7123326..7123422 1..97 470 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11236014..11236204 95..285 955 100 Plus
2R 25286936 2R 11235860..11235956 1..97 485 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11237213..11237403 95..285 955 100 Plus
2R 25260384 2R 11237059..11237155 1..97 485 100 Plus
Blast to na_te.dros performed on 2019-03-16 21:53:15 has no hits.

RT07907.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:54:12 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7123326..7123422 1..97 98 -> Plus
chr2R 7123483..7123670 98..285 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 17:17:04 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..283 1..283 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:42 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..285 1..285 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:10 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..285 1..285 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:35:32 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..285 1..285 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 17:17:04 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..283 1..283 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:42 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..285 1..285 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:10 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..285 1..285 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:35:32 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
CG34223-RA 1..285 1..285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:12 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235860..11235956 1..97 100 -> Plus
2R 11236017..11236204 98..285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:12 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235860..11235956 1..97 100 -> Plus
2R 11236017..11236204 98..285 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:54:12 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11235860..11235956 1..97 100 -> Plus
2R 11236017..11236204 98..285 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:10 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7123365..7123461 1..97 100 -> Plus
arm_2R 7123522..7123709 98..285 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:17 Download gff for RT07907.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11237059..11237155 1..97 100 -> Plus
2R 11237216..11237403 98..285 100   Plus

RT07907.pep Sequence

Translation from 0 to 284

> RT07907.pep
MFRLLLLWITVGLVAALDEREFDPQVAPPQSSVPKPFQLWRSFASHVRLV
FSRLQPKSPTPPTVRTKTGITTTTPEPELQFYGALNPIYQTGNF*

RT07907.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12531-PA 95 GF12531-PA 1..95 1..94 295 75 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20173-PA 94 GG20173-PA 1..94 1..94 435 88.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19939-PA 104 GH19939-PA 10..104 5..94 171 44.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-PA 94 CG34223-PA 1..94 1..94 496 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:37:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19896-PA 101 GI19896-PA 19..101 15..94 151 41.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17713-PA 102 GL17713-PA 10..102 7..94 231 53.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:37:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24885-PA 102 GA24885-PA 10..102 7..94 220 51 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21262-PA 94 GM21262-PA 1..94 1..94 468 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10776-PA 94 GD10776-PA 1..94 1..94 471 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:37:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15065-PA 94 GJ15065-PA 15..94 14..94 155 45.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12863-PA 94 GE12863-PA 1..94 1..94 389 89.4 Plus

RT07907.hyp Sequence

Translation from 1 to 282

> RT07907.hyp
MFRLLLLWITVGLVAALDEREFDPQVAPPQSSVPKPFQLWRSFASHVRLV
FSRLQPKSPTPPTVRTKTGITTTTPEPELQFYGALNPIYQTGNF

RT07907.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG34223-PA 94 CG34223-PA 1..94 1..94 496 100 Plus