Clone RT07968 Report

Search the DGRC for RT07968

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:79
Well:68
Vector:pCR2.1
Associated Gene/TranscriptCG34022-RA
Protein status:RT07968.pep: wuzgold
Sequenced Size:845

Clone Sequence Records

RT07968.complete Sequence

845 bp assembled on 2010-04-26

GenBank Submission: BT124812.1

> RT07968.complete
GTCAGCTTCGATACTCGAACTCGTATTCGCATCCATGCAGACTTCCAACT
AACATATGTTATCCATGTCCATGTCACATTAGGCAATGTTTGACAGCCGC
CAATCCGCAACATTGTAAGATGGGCAACCGCATTGCATCCAGTAGAGGCG
CCGATGGAGCTGGCGAGGGAGCCGCCGGCGAGGGTAACTCCAGGTTCAAT
ACCCGCCGCCGATATCAGCAGCACAAGAGGGAATACTGTCTGCAGAACGA
GTACCGATCGAAGACCCTGCCCGCCCGCCATCCGCACCACAGTGATCCCC
ACCAGAGCCACCAGAAGTGCAGCGCCCAGGAGCGACTGGGCTCGAGCAGT
TGCTTGGGAGCTGGCCAGAATGCATCCAACAACGCAACGCCGCACAATGG
AGAGACGTCGAGGGTGCTCTTTCTGCTCTACTTGATTCACCGCACCTGGA
ACGTGGTCATGGACACGATGGACTCACGCACCAAGAGTCGTTCGGCTAGA
GGGAATTCCCCTCAAAAAGAGGGGCCCGTGGATATTGAACTCCAGCCGCG
GGTTCTGGATGAGGAATGCTCCATTGGCATCACCGACTTGGACGCCTCAT
CGTTCTGCTCCCAGTACTCGTGCTGCAGCTGCAGCTACTGTGATGTGGAA
ACCACTGGGACCCAGACCAATGTCTACAGCTCAATAGGCGACGACTTTTC
CCTGGACTCCATGTTCGAGGCGGGAAAGTCGATGGTTGACAGGTGAGCAA
AGCTACAGACTATTCAAACCCCTTAGCCACGTAGCAGGCAGCTTTTGTCA
GAGGTTGATGGGAGACGCATTGCATACTTTCAGGCCGAACGAAGT

RT07968.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG34022.b 1301 CG34022.b 457..1301 1..845 4225 100 Plus
CG34022-RA 845 CG34022-RA 1..845 1..845 4225 100 Plus
CG34022.a 810 CG34022.a 69..810 82..823 3710 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:06:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1205465..1205951 1..487 2420 99.8 Plus
chr3L 24539361 chr3L 1206048..1206407 486..845 1725 98.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:06:27
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1205946..1206432 1..487 2435 100 Plus
3L 28110227 3L 1206529..1206888 486..845 1800 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1205946..1206432 1..487 2435 100 Plus
3L 28103327 3L 1206529..1206888 486..845 1800 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:06:27 has no hits.

RT07968.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:07:06 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1205465..1205951 1..487 99 -> Plus
chr3L 1206050..1206407 488..845 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 17:01:42 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
CG34022-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:31:03 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
CG34022-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:03:04 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
mwh-RB 1..631 120..754 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:27:23 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
mwh-RB 1..631 120..754 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 17:01:42 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
CG34022-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:31:02 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
CG34022-RA 1..627 120..746 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:03:04 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
mwh-RB 530..1198 82..754 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:27:23 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
mwh-RB 530..1198 82..754 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:06 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1205946..1206432 1..487 100 -> Plus
3L 1206531..1206888 488..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:06 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1205946..1206432 1..487 100 -> Plus
3L 1206531..1206888 488..845 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:07:06 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1205946..1206432 1..487 100 -> Plus
3L 1206531..1206888 488..845 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:03:04 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1205946..1206432 1..487 100 -> Plus
arm_3L 1206531..1206888 488..845 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:01 Download gff for RT07968.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1205946..1206432 1..487 100 -> Plus
3L 1206531..1206888 488..845 100   Plus

RT07968.pep Sequence

Translation from 2 to 745

> RT07968.pep
QLRYSNSYSHPCRLPTNICYPCPCHIRQCLTAANPQHCKMGNRIASSRGA
DGAGEGAAGEGNSRFNTRRRYQQHKREYCLQNEYRSKTLPARHPHHSDPH
QSHQKCSAQERLGSSSCLGAGQNASNNATPHNGETSRVLFLLYLIHRTWN
VVMDTMDSRTKSRSARGNSPQKEGPVDIELQPRVLDEECSIGITDLDASS
FCSQYSCCSCSYCDVETTGTQTNVYSSIGDDFSLDSMFEAGKSMVDR*

RT07968.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24434-PA 202 GF24434-PA 1..202 40..247 671 73.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14758-PA 210 GG14758-PA 1..210 40..247 859 92.4 Plus
Dere\GG19821-PA 210 GG19821-PA 1..210 40..247 859 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15484-PA 193 GH15484-PA 1..193 40..247 492 60.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
mwh-PB 1068 CG43772-PB 1..207 40..246 1108 100 Plus
mwh-PC 1069 CG43772-PC 1..208 40..246 1096 99.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16760-PA 181 GI16760-PA 1..178 40..244 424 55.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16155-PA 196 GL16155-PA 31..194 87..246 449 73.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28403-PA 213 GA28403-PA 1..211 40..246 583 72 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14377-PA 208 GM14377-PA 1..208 40..247 1093 98.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13592-PA 208 GD13592-PA 1..208 40..247 1095 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12506-PA 188 GJ12506-PA 1..185 40..244 511 63.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21073-PA 219 GK21073-PA 24..219 59..247 464 65.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21121-PA 211 GE21121-PA 1..211 40..247 949 93.4 Plus

RT07968.hyp Sequence

Translation from 2 to 745

> RT07968.hyp
QLRYSNSYSHPCRLPTNICYPCPCHIRQCLTAANPQHCKMGNRIASSRGA
DGAGEGAAGEGNSRFNTRRRYQQHKREYCLQNEYRSKTLPARHPHHSDPH
QSHQKCSAQERLGSSSCLGAGQNASNNATPHNGETSRVLFLLYLIHRTWN
VVMDTMDSRTKSRSARGNSPQKEGPVDIELQPRVLDEECSIGITDLDASS
FCSQYSCCSCSYCDVETTGTQTNVYSSIGDDFSLDSMFEAGKSMVDR*

RT07968.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
mwh-PB 1068 CG43772-PB 1..207 40..246 1108 100 Plus
mwh-PC 1069 CG43772-PC 1..208 40..246 1096 99.5 Plus