Clone RT07973 Report

Search the DGRC for RT07973

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:79
Well:73
Vector:pCR2.1
Associated Gene/TranscriptCG34444-RA
Protein status:RT07973.pep: gold
Sequenced Size:888

Clone Sequence Records

RT07973.complete Sequence

888 bp assembled on 2010-07-19

GenBank Submission: BT124847.2

> RT07973.complete
ATGGATGGTCGTGGAACATTCCTAGTTCTTCTGATTTTTGGTTTTTTCAG
GAACTCACAGGAAAAATTTGTTTGGTGTACGGGTGGAGCATCTTCGCTTT
TTGTGGCCATCGCTTTGCCTTTGGACTTACGGTTTGAAAAAGCCTTTTTG
TCCTATAATTTTGAAGTGTCCTACGATTTACCAAGATCGTGGAAACAGAA
ACCACCGTTTTTGCGACATGGAAATGGCACGAATGATGAAAGTTTACTGA
GTGATCACCATGGCCATCATCAGAATGATGATTTCGTTTACGATGACTAT
TACGATGATGATCAAAACTCTGGTAATAAGCACAAACACAAACACCATCC
ACATCATCATGATAAGAAAAAGAAGAAGAGTAAGCCTAAGCCCGGTTCTG
TTATCAAGCCACAGAAAAATAAGCCCAAGCATAAGCATAAGAAAAAGCAC
AAGTCAAAGCCAAAGCCACCGCCAGAAGTGGATGAGGATGACTACAAGGA
CTTCTTTCAGGGATTTCCCTTGGATGGCATGGGTGAATCTGTGGGCAGAG
ATCGCCAGAGTAGGTCACTACTCTCACGCACTAAGTTCTATTATATAATC
AACCATCGGTTCGAATTGCATGGATTAGGCGCAGGCGACAGCTGTTTATT
AAGACTGATTTGTGAGGCAAATAGCTACCAATTGGGAGATCTCAATGGTG
TGCTAGGCAGCTTAATACATGTAATGTTCAGTCCCAGCAGCTCTCGGTAT
GAGGAATTACCTAAGCGTTACTACATCGCAGAATTGGATGGTCGGAATGG
CAACTGCGGAGGCTATCGAGTGCAATGTGAGCATAGTGTTCTCGACATGA
TCACGCAACCTGTGAAAAATAAAAACAAAATGCACTAA

RT07973.complete Blast Records

Blast to MB8.fasta performed 2010-07-20 13:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34444-RA 996 CG34444-RA 102..989 1..888 4440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10256888..10257293 213..618 2030 100 Plus
chr2R 21145070 chr2R 10257353..10257621 618..886 1345 100 Plus
chr2R 21145070 chr2R 10256707..10256824 96..213 590 100 Plus
chr2R 21145070 chr2R 10256546..10256641 1..96 465 99 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:31:07
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14369584..14369989 213..618 2030 100 Plus
2R 25286936 2R 14370049..14370319 618..888 1355 100 Plus
2R 25286936 2R 14369403..14369520 96..213 590 100 Plus
2R 25286936 2R 14369242..14369337 1..96 480 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14370783..14371188 213..618 2030 100 Plus
2R 25260384 2R 14371248..14371518 618..888 1355 100 Plus
2R 25260384 2R 14370602..14370719 96..213 590 100 Plus
2R 25260384 2R 14370441..14370536 1..96 480 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:31:07 has no hits.

RT07973.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:32:00 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10256546..10256641 1..96 98 -> Plus
chr2R 10257353..10257623 618..888 100   Plus
chr2R 10256708..10256824 97..213 100 -> Plus
chr2R 10256889..10257292 214..617 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-19 14:41:38 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 1..886 1..886 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:11 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 1..888 1..888 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:32:11 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 1..888 1..888 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:42:04 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 1..888 1..888 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-19 14:41:37 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 1..886 1..886 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:11 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 1..888 1..888 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:32:11 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 26..913 1..888 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:42:04 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34444-RA 26..913 1..888 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:32:00 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14370049..14370319 618..888 100   Plus
2R 14369242..14369337 1..96 100 -> Plus
2R 14369404..14369520 97..213 100 -> Plus
2R 14369585..14369988 214..617 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:32:00 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14370049..14370319 618..888 100   Plus
2R 14369242..14369337 1..96 100 -> Plus
2R 14369404..14369520 97..213 100 -> Plus
2R 14369585..14369988 214..617 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:32:00 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14370049..14370319 618..888 100   Plus
2R 14369242..14369337 1..96 100 -> Plus
2R 14369404..14369520 97..213 100 -> Plus
2R 14369585..14369988 214..617 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:32:11 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10257554..10257824 618..888 100   Plus
arm_2R 10256747..10256842 1..96 100 -> Plus
arm_2R 10256909..10257025 97..213 100 -> Plus
arm_2R 10257090..10257493 214..617 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:40:52 Download gff for RT07973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14370784..14371187 214..617 100 -> Plus
2R 14371248..14371518 618..888 100   Plus
2R 14370441..14370536 1..96 100 -> Plus
2R 14370603..14370719 97..213 100 -> Plus

RT07973.pep Sequence

Translation from 0 to 887

> RT07973.pep
MDGRGTFLVLLIFGFFRNSQEKFVWCTGGASSLFVAIALPLDLRFEKAFL
SYNFEVSYDLPRSWKQKPPFLRHGNGTNDESLLSDHHGHHQNDDFVYDDY
YDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVIKPQKNKPKHKHKKKH
KSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYII
NHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRY
EELPKRYYIAELDGRNGNCGGYRVQCEHSVLDMITQPVKNKNKMH*

RT07973.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13499-PA 217 GF13499-PA 32..190 155..289 271 37.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20447-PA 189 GG20447-PA 32..175 155..288 279 43.2 Plus
Dere\GG20448-PA 397 GG20448-PA 309..360 56..107 203 86.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:40:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19744-PA 408 GH19744-PA 194..395 30..287 330 32.9 Plus
Dgri\GH19744-PA 408 GH19744-PA 1..197 35..288 300 29.5 Plus
Dgri\GH14426-PA 208 GH14426-PA 88..205 176..285 145 34.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG34444-PA 295 CG34444-PA 1..295 1..295 1626 100 Plus
CG34442-PA 245 CG34442-PA 16..228 12..285 281 28.4 Plus
CG34184-PA 224 CG34184-PA 64..209 155..288 279 42.6 Plus
CG34443-PA 239 CG34443-PA 119..229 179..290 277 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20278-PA 799 GI20278-PA 670..788 162..288 384 56.7 Plus
Dmoj\GI20278-PA 799 GI20278-PA 443..550 185..293 288 50.5 Plus
Dmoj\GI20278-PA 799 GI20278-PA 92..197 183..289 278 48.6 Plus
Dmoj\GI20278-PA 799 GI20278-PA 253..358 183..289 275 49.5 Plus
Dmoj\GI13557-PA 211 GI13557-PA 73..208 160..285 166 33.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:40:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10688-PA 298 GL10688-PA 3..298 7..295 734 56.5 Plus
Dper\GL10687-PA 397 GL10687-PA 277..386 179..289 273 47.7 Plus
Dper\GL24802-PA 218 GL24802-PA 72..217 160..288 151 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24448-PA 298 GA24448-PA 3..287 7..288 737 58 Plus
Dpse\GA24447-PA 433 GA24447-PA 319..422 185..289 271 49.5 Plus
Dpse\GA24447-PA 433 GA24447-PA 113..219 183..289 270 49.1 Plus
Dpse\GA12769-PA 218 GA12769-PA 72..217 160..288 149 32.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21535-PA 479 GM21535-PA 310..479 56..223 381 74.1 Plus
Dsec\GM19477-PA 187 GM19477-PA 69..172 185..288 275 50.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11043-PA 196 GD11043-PA 34..181 155..288 276 39.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22007-PA 262 GJ22007-PA 4..250 5..288 611 49.6 Plus
Dvir\GJ22006-PA 369 GJ22006-PA 164..358 33..289 333 32.3 Plus
Dvir\GJ11918-PA 215 GJ11918-PA 77..212 160..285 160 33.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21474-PA 413 GK21474-PA 299..400 185..287 279 52.4 Plus
Dwil\GK21474-PA 413 GK21474-PA 92..198 183..289 262 47.2 Plus
Dwil\GK16780-PA 214 GK16780-PA 88..211 160..285 154 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18111-PA 195 GE18111-PA 82..180 190..288 273 53 Plus

RT07973.hyp Sequence

Translation from 1 to 885

> RT07973.hyp
MDGRGTFLVLLIFGFFRNSQEKFVWCTGGASSLFVAIALPLDLRFEKAFL
SYNFEVSYDLPRSWKQKPPFLRHGNGTNDESLLSDHHGHHQNDDFVYDDY
YDDDQNSGNKHKHKHHPHHHDKKKKKSKPKPGSVIKPQKNKPKHKHKKKH
KSKPKPPPEVDEDDYKDFFQGFPLDGMGESVGRDRQSRSLLSRTKFYYII
NHRFELHGLGAGDSCLLRLICEANSYQLGDLNGVLGSLIHVMFSPSSSRY
EELPKRYYIAELDGRNGNCGGYRVQCEHSVLDMITQPVKNKNKMH

RT07973.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:34:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG34444-PA 295 CG34444-PA 1..295 1..295 1626 100 Plus
CG34442-PA 245 CG34442-PA 16..228 12..285 281 28.4 Plus
CG34184-PA 224 CG34184-PA 64..209 155..288 279 42.6 Plus
CG34443-PA 239 CG34443-PA 119..229 179..290 277 50 Plus