Clone RT08033 Report

Search the DGRC for RT08033

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:80
Well:33
Vector:pCR2.1
Associated Gene/TranscriptCG14490-RA
Protein status:RT08033.pep: gold
Sequenced Size:594

Clone Sequence Records

RT08033.complete Sequence

594 bp assembled on 2010-04-26

GenBank Submission: BT124799.1

> RT08033.complete
ATGTCGTCGCGTACGAGCGGATATAGTAGTGGAGTTCGCTCTCAACGTTA
TCCTGGTGGGCAGTACCAGGGCAAATGGTTGGGCCAGCAGCCTCACGGGT
TTGGGGTAAAGCAAACGAGCAGTGGACTTGTCTACGAGGGTCACTGGCAG
AAGGGTCAACGGCATGGCATCGGAAGTTTGCGTCGCAAGGAGCTCGATGG
CCGCATGGAACGCATCTACGTGGGTCAGTGGCGGGAGAACAAGCGGAGTG
GCGAGGGCAAGCAGTTCTATCCGGACGGATCCGTCTACTTTGGTCAGTGG
CTAGCGGACCAGCGAAGTGGAGAGGGCATCCTATGGCAGGCGGATGGCGG
CATCTATGTGGGCGAGTGGCTTCGGGACAAGATGCACGAAAAGGGTTTAC
TTTTCACGGCAACGGGAAATCGCTACGTGGGTCAATTTGAAGGAGGCTGC
AAATCGGGCTCAGGTGTATTTTACCATGCCAGCAATGGACAGCGGATTCA
GCACGGTTTTTGGAGCAAGGACATCTGTAGAACGTCACTACTGTCCCTGC
CACAAGATAAAAACAATGAATTTATGTCAAAAGCTCTTTTGTAA

RT08033.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14490-RA 733 CG14490-RA 140..733 1..594 2970 100 Plus
thr-RB 4582 thr-RB 4342..4527 594..409 930 100 Minus
thr.a 4527 thr.a 4335..4472 546..409 690 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13747988..13748396 1..409 2030 99.8 Plus
chr2R 21145070 chr2R 13748517..13748701 409..592 830 97.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17860799..17861207 1..409 2045 100 Plus
2R 25286936 2R 17861328..17861513 409..594 930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17861998..17862406 1..409 2045 100 Plus
2R 25260384 2R 17862527..17862712 409..594 930 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:49:53 has no hits.

RT08033.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:50:58 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13747988..13748396 1..409 99 -> Plus
chr2R 13748518..13748703 410..594 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-04-26 14:40:01 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 1..592 1..592 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:38 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 1..594 1..594 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:17 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 1..594 1..594 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:30 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 1..594 1..594 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-04-26 14:40:00 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 1..592 1..592 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:38 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 1..594 1..594 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:17 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 40..633 1..594 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:30 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
CG14490-RA 40..633 1..594 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:58 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17860799..17861207 1..409 100 -> Plus
2R 17861329..17861513 410..594 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:58 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17860799..17861207 1..409 100 -> Plus
2R 17861329..17861513 410..594 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:50:58 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17860799..17861207 1..409 100 -> Plus
2R 17861329..17861513 410..594 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:17 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13748304..13748712 1..409 100 -> Plus
arm_2R 13748834..13749018 410..594 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:15:43 Download gff for RT08033.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17861998..17862406 1..409 100 -> Plus
2R 17862528..17862712 410..594 100   Plus

RT08033.pep Sequence

Translation from 0 to 593

> RT08033.pep
MSSRTSGYSSGVRSQRYPGGQYQGKWLGQQPHGFGVKQTSSGLVYEGHWQ
KGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQW
LADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGC
KSGSGVFYHASNGQRIQHGFWSKDICRTSLLSLPQDKNNEFMSKALL*

RT08033.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11683-PA 190 GF11683-PA 1..190 1..186 689 68.9 Plus
Dana\GF11503-PA 305 GF11503-PA 17..203 9..181 411 48.7 Plus
Dana\GF14224-PA 346 GF14224-PA 35..180 30..172 149 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:32:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21832-PA 189 GG21832-PA 1..188 1..188 860 88.3 Plus
Dere\GG23038-PA 305 GG23038-PA 17..203 9..181 373 45.5 Plus
Dere\GG23819-PA 344 GG23819-PA 51..181 45..172 146 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22033-PA 201 GH22033-PA 1..201 1..195 566 56.2 Plus
Dgri\GH22662-PA 300 GH22662-PA 17..214 9..190 405 47 Plus
Dgri\GH11395-PA 341 GH11395-PA 36..134 30..133 158 41.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14490-PA 197 CG14490-PA 1..197 1..197 1082 100 Plus
CG30429-PA 305 CG30429-PA 17..203 9..181 412 45 Plus
CG5458-PA 344 CG5458-PA 30..180 24..171 182 32.1 Plus
CG5458-PA 344 CG5458-PA 25..141 42..164 170 34.1 Plus
jp-PE 1054 CG4405-PE 77..194 19..137 162 34.7 Plus
jp-PD 1054 CG4405-PD 77..194 19..137 162 34.7 Plus
jp-PA 1054 CG4405-PA 77..194 19..137 162 34.7 Plus
jp-PB 1054 CG4405-PB 77..194 19..137 162 34.7 Plus
rtp-PA 198 CG10233-PA 25..158 15..170 161 32.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19121-PA 200 GI19121-PA 1..200 1..196 573 57 Plus
Dmoj\GI21175-PA 295 GI21175-PA 17..203 9..181 377 46.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17232-PA 186 GL17232-PA 1..183 1..183 575 61.3 Plus
Dper\GL16824-PA 305 GL16824-PA 17..203 9..181 402 50.3 Plus
Dper\GL24745-PA 343 GL24745-PA 36..147 30..152 155 38.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:32:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13025-PA 186 GA13025-PA 1..183 1..183 573 61.3 Plus
Dpse\GA15841-PA 305 GA15841-PA 17..203 9..181 402 50.3 Plus
Dpse\GA18894-PA 343 GA18894-PA 36..147 30..152 155 38.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21832-PA 196 GM21832-PA 1..196 1..197 946 93.4 Plus
Dsec\GM11928-PA 305 GM11928-PA 17..216 9..193 372 43.6 Plus
Dsec\GM16708-PA 305 GM16708-PA 17..216 9..193 372 43.1 Plus
Dsec\GM10213-PA 344 GM10213-PA 51..181 45..172 146 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:32:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11326-PA 196 GD11326-PA 1..196 1..197 941 93.9 Plus
Dsim\GD11922-PA 305 GD11922-PA 17..216 9..193 372 43.6 Plus
Dsim\GD23870-PA 344 GD23870-PA 51..181 45..172 144 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22253-PA 194 GJ22253-PA 1..193 1..189 562 57 Plus
Dvir\GJ21032-PA 295 GJ21032-PA 16..213 8..190 391 45.5 Plus
Dvir\GJ16897-PA 346 GJ16897-PA 38..134 32..133 141 39.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:32:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22235-PA 195 GK22235-PA 1..193 1..188 588 61.7 Plus
Dwil\GK21721-PA 298 GK21721-PA 17..203 9..181 368 46.6 Plus
Dwil\GK23959-PA 342 GK23959-PA 36..134 30..133 148 39.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:32:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11909-PA 189 GE11909-PA 1..188 1..188 840 85.1 Plus
Dyak\GE14468-PA 305 GE14468-PA 17..203 9..181 367 45.5 Plus
Dyak\GE18622-PA 344 GE18622-PA 51..181 45..172 145 33.1 Plus

RT08033.hyp Sequence

Translation from 1 to 591

> RT08033.hyp
MSSRTSGYSSGVRSQRYPGGQYQGKWLGQQPHGFGVKQTSSGLVYEGHWQ
KGQRHGIGSLRRKELDGRMERIYVGQWRENKRSGEGKQFYPDGSVYFGQW
LADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGC
KSGSGVFYHASNGQRIQHGFWSKDICRTSLLSLPQDKNNEFMSKALL

RT08033.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 14:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG14490-PA 197 CG14490-PA 1..197 1..197 1082 100 Plus
CG30429-PA 305 CG30429-PA 17..203 9..181 412 45 Plus
CG5458-PA 344 CG5458-PA 30..180 24..171 182 32.1 Plus
CG5458-PA 344 CG5458-PA 25..141 42..164 170 34.1 Plus
jp-PE 1054 CG4405-PE 77..194 19..137 162 34.7 Plus
rtp-PA 198 CG10233-PA 25..158 15..170 161 32.5 Plus