Clone RT09601 Report

Search the DGRC for RT09601

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:96
Well:1
Vector:pCR2.1
Associated Gene/TranscriptCG15250-RA
Protein status:RT09601.pep: Imported from assembly
Sequenced Size:281

Clone Sequence Records

RT09601.complete Sequence

281 bp assembled on 2011-07-27

GenBank Submission: BT125026.2

> RT09601.complete
GGGGGGAAAAGATCTGAGCGATGCCGCCGAAATCATGAGCGATGCCTCCC
TGGAACTTCCCTCTGAACTATTGAACAAATCTCTAGTGACGGTCACCAAT
ATCTCAAAGTCGTTGTCTCGCCTGATTTTGAACTCCGCTCGCCGCTACTC
CCGCTTCGTGCTCTTCTTTAAGCCAGTTTTCGGAGATGCCCTGGTGGTCA
AGGGATCTGAAGATCCCACTACAACCACCACAGTACGCACCACCACAACC
ACCGAAGAGACTGACAAGCTCAACGAAGTCA

RT09601.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:40:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG15250-RA 283 CG15250-RA 1..280 1..280 1385 99.6 Plus
CG1889-RA 1591 CG1889-RA 1343..1493 280..130 740 99.3 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 10:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 9858348..9858498 280..130 740 99.3 Minus
chrX 22417052 chrX 9858658..9858787 130..1 650 100 Minus
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 10:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 9966714..9966864 280..130 740 99.3 Minus
X 23542271 X 9967024..9967153 130..1 650 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:56:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 9974812..9974962 280..130 740 99.3 Minus
X 23527363 X 9975122..9975251 130..1 650 100 Minus
Blast to na_te.dros performed on 2019-03-15 10:50:39 has no hits.

RT09601.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 10:51:40 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 9858348..9858497 131..280 99 <- Minus
chrX 9858658..9858787 1..130 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2011-03-16 13:21:28 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15250-RA 1..246 35..280 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-07-27 09:25:28 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15250-RA 1..246 35..281 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:26:31 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG43386-RB 180..459 1..281 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:13:15 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG43386-RB 180..459 1..281 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-06-16 14:49:23 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15250-RA 1..246 35..280 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-07-27 09:25:28 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15250-RA 1..246 35..280 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:26:31 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG43386-RB 338..617 1..280 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:13:15 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
CG43386-RB 338..617 1..280 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:40 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
X 9966714..9966863 131..280 99 <- Minus
X 9967024..9967153 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:40 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
X 9966714..9966863 131..280 99 <- Minus
X 9967024..9967153 1..130 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 10:51:40 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
X 9966714..9966863 131..280 99 <- Minus
X 9967024..9967153 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:26:31 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 9860747..9860896 131..280 99 <- Minus
arm_X 9861057..9861186 1..130 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:39:29 Download gff for RT09601.complete
Subject Subject Range Query Range Percent Splice Strand
X 9974812..9974961 131..280 99 <- Minus
X 9975122..9975251 1..130 100   Minus

RT09601.hyp Sequence

Translation from 0 to 280

> RT09601.hyp
GGKDLSDAAEIMSDASLELPSELLNKSLVTVTNISKSLSRLILNSARRYS
RFVLFFKPVFGDALVVKGSEDPTTTTTVRTTTTTEETDKLNEV

RT09601.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG43386-PB 153 CG15250-PA 61..153 1..93 452 100 Plus

RT09601.pep Sequence

Translation from 1 to 280

> RT09601.pep
GGKDLSDAAEIMSDASLELPSELLNKSLVTVTNISKSLSRLILNSARRYS
RFVLFFKPVFGDALVVKGSEDPTTTTTVRTTTTTEETDKLNEV

RT09601.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19855-PA 61 GF19855-PA 1..61 42..93 169 73.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:13:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18952-PA 82 GG18952-PA 1..82 12..93 335 96.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12909-PA 115 GH12909-PA 19..115 1..93 259 61.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG43386-PB 153 CG15250-PA 61..153 1..93 452 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16597-PA 112 GL16597-PA 18..112 1..93 311 75.8 Plus
Dper\GL22358-PA 103 GL22358-PA 9..103 1..93 309 75.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13600-PA 112 GA13600-PA 18..112 1..93 311 75.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18822-PA 82 GM18822-PA 1..82 12..93 396 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24552-PA 153 GD24552-PA 66..153 12..93 186 64.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:13:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19427-PA 82 GJ19427-PA 1..82 13..93 258 74.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25562-PA 116 GK25562-PA 18..116 1..93 323 67.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:13:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15424-PA 85 GE15424-PA 1..85 12..93 312 95.3 Plus