Clone RT10714 Report

Search the DGRC for RT10714

Clone and Library Details

Library:RT
Tissue Source:D melanogaster pooled RNA
Created by:
Date Registered:2006-04-14
Comments:TA cloning vector from Invitrogen
Original Plate Number:107
Well:14
Vector:pCR2.1
Associated Gene/TranscriptCG16813-RA
Protein status:RT10714.pep: gold
Sequenced Size:718

Clone Sequence Records

RT10714.complete Sequence

718 bp assembled on 2011-02-23

GenBank Submission: BT126095.1

> RT10714.complete
GTCGTCTCGAAGACAGCAAAGCGAACACCACTACTCTTAATCAAGAATGG
ATAACTATAACCACAAGAAATTCACTGGAGCTCTGAAGCGAAAGCGCAGC
ATGGATGCGGACTCTGATGACGATGTGGTCTTCATTATGGAACAGCCGGG
CCAACGCACTCCAGAGCAGCCGCAGCCTAAGCGTCGCTTCTTCCGACCCT
GGATGGATGAGTCTCCGGAAGAGGAGCAACCACAGCCGCCACGTAAGATT
GTGGCTACATCGACACCGCCGCCACAACAAGTGGATGGCACCTACCACGC
TAACATGGTGCGCAATCACCACAAGCGCCGCCAGCGCAGTCCACAGGAGC
AACTGCGTCGGGATCGCAACACCTTGGCCAGCCTGCGCCATCGACGCTCC
CAGCAGCAACAGCAGCAGCTCATCGAACAACAATACCTGACCAGTCGCAT
TCAGCACGAGGCCAATCTGCAGCAGCAGATCCGCCTGAGTCTCTACTATG
TGCGCTTCCTGCAGCAGGCGATGGCCTCCACGGAGCCACTGCCTCCCACA
CAGCCAAGGCACATGATGCCGCGCCAACAGACCACCACCCAGCATCCTTG
ATGGGTGGACATGGTGCAACGACTGGGCGCTGCTCAATGCGCCCTAACTT
ATTGTAGAAAAGCTGAATAGTGATTGTGATTACTTTTAAAGTTTAATTTA
TTTATCTGGTTGACTAAA

RT10714.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:45:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13226483..13227197 1..715 3515 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13227807..13228524 1..718 3575 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:07:55
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13227807..13228524 1..718 3575 99.8 Plus
Blast to na_te.dros performed 2019-03-17 01:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6720..6883 318..478 164 61.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6900 288..471 154 57.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2314..2481 315..484 150 59.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6856 344..478 134 59.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2608..2875 225..492 132 54.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6746..6823 401..478 128 65.8 Plus
roo 9092 roo DM_ROO 9092bp 1052..1146 380..477 121 63.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6725..6802 401..478 119 64.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6767..6847 401..478 118 64.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6719..6799 398..478 116 63.4 Plus

RT10714.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:45:55 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13226483..13227197 1..715 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-17 17:08:22 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
CG16813-RA 1..555 47..601 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:51:41 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
CG16813-RA 1..555 47..601 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 18:09:59 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
CG16813-RA 1..555 47..601 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-17 17:08:22 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
CG16813-RA 1..555 47..601 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:51:41 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
CG16813-RA 1..715 1..715 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 18:09:59 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
CG16813-RA 1..715 1..715 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:55 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13227807..13228521 1..715 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:55 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13227807..13228521 1..715 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:45:55 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13227807..13228521 1..715 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:51:41 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13227807..13228521 1..715 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:59:59 Download gff for RT10714.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13227807..13228521 1..715 99   Plus

RT10714.pep Sequence

Translation from 46 to 600

> RT10714.pep
MDNYNHKKFTGALKRKRSMDADSDDDVVFIMEQPGQRTPEQPQPKRRFFR
PWMDESPEEEQPQPPRKIVATSTPPPQQVDGTYHANMVRNHHKRRQRSPQ
EQLRRDRNTLASLRHRRSQQQQQQLIEQQYLTSRIQHEANLQQQIRLSLY
YVRFLQQAMASTEPLPPTQPRHMMPRQQTTTQHP*

RT10714.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23075-PA 188 GF23075-PA 1..188 1..184 649 77.9 Plus
Dana\GF23086-PA 199 GF23086-PA 1..162 1..159 254 45.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:54:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23825-PA 184 GG23825-PA 1..184 1..184 797 95.7 Plus
Dere\GG23826-PA 192 GG23826-PA 6..168 3..175 281 44.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH25089-PA 194 GH25089-PA 12..175 3..169 395 53.4 Plus
Dgri\GH22260-PA 194 GH22260-PA 12..175 3..169 395 53.4 Plus
Dgri\GH25090-PA 200 GH25090-PA 10..164 2..159 248 42.8 Plus
Dgri\GH22261-PA 200 GH22261-PA 10..164 2..159 248 42.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG16813-PB 184 CG16813-PB 1..184 1..184 981 100 Plus
CG16813-PA 184 CG16813-PA 1..184 1..184 981 100 Plus
CG16815-PB 192 CG16815-PB 6..171 3..178 320 44.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17610-PA 190 GI17610-PA 11..163 3..167 390 56.5 Plus
Dmoj\GI17611-PA 198 GI17611-PA 6..162 2..159 276 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:54:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26308-PA 193 GL26308-PA 1..187 1..183 615 69.3 Plus
Dper\GL26309-PA 177 GL26309-PA 11..141 14..159 152 33.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14163-PA 193 GA14163-PA 1..187 1..183 615 69.3 Plus
Dpse\GA28811-PA 184 GA28811-PA 1..148 1..159 180 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10279-PA 184 GM10279-PA 1..184 1..184 922 96.2 Plus
Dsec\GM10290-PA 192 GM10290-PA 5..168 2..175 275 43.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:54:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23874-PA 184 GD23874-PA 1..184 1..184 936 97.8 Plus
Dsim\GD24073-PA 98 GD24073-PA 1..98 87..184 460 96.9 Plus
Dsim\GD23875-PA 192 GD23875-PA 5..168 2..175 281 43.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:54:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17955-PA 182 GJ17955-PA 9..167 3..175 390 57.5 Plus
Dvir\GJ17956-PA 207 GJ17956-PA 15..171 3..159 254 43.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14547-PA 180 GK14547-PA 1..170 1..173 428 57.8 Plus
Dwil\GK14548-PA 177 GK14548-PA 20..140 41..159 246 50.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18628-PA 184 GE18628-PA 1..184 1..184 849 94.6 Plus
Dyak\GE18629-PA 255 GE18629-PA 69..231 3..175 276 43.5 Plus

RT10714.hyp Sequence

Translation from 46 to 600

> RT10714.hyp
MDNYNHKKFTGALKRKRSMDADSDDDVVFIMEQPGQRTPEQPQPKRRFFR
PWMDESPEEEQPQPPRKIVATSTPPPQQVDGTYHANMVRNHHKRRQRSPQ
EQLRRDRNTLASLRHRRSQQQQQQLIEQQYLTSRIQHEANLQQQIRLSLY
YVRFLQQAMASTEPLPPTQPRHMMPRQQTTTQHP*

RT10714.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG16813-PB 184 CG16813-PB 1..184 1..184 981 100 Plus
CG16813-PA 184 CG16813-PA 1..184 1..184 981 100 Plus
CG16815-PB 192 CG16815-PB 6..171 3..178 320 44.5 Plus