Clone SD01117 Report

Search the DGRC for SD01117

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:11
Well:17
Vector:pOT2
Associated Gene/TranscriptCG3501-RA
Protein status:SD01117.pep: gold
Preliminary Size:1020
Sequenced Size:821

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3501 2001-01-01 Release 2 assignment
CG3501 2003-01-01 Sim4 clustering to Release 3
CG3501 2003-01-15 Blastp of sequenced clone
CG3501 2008-04-29 Release 5.5 accounting
CG3501 2008-08-15 Release 5.9 accounting
CG3501 2008-12-18 5.12 accounting

Clone Sequence Records

SD01117.complete Sequence

821 bp (821 high quality bases) assembled on 2003-01-15

GenBank Submission: AY075566

> SD01117.complete
AGAAAATGTGCGACTACAAGGTCTCGGAGCGGGCGTACGCCAAGTTGATA
TTCCACGCGGCCAAGTATCCACACCAGGCGGTCAACGGACTCTTGCTGGC
CGAGAAGACATCGAAGGGCTCCCAAGTGGAAATCGTGGATGCGATTCCGC
TTTTCCACCAGTGCCTGTATGTCACCCCCATGGCGGAGGTGGCCCTCATG
CTGATCGATGCCCACGCCGAACGGGAAGGATTAGTAATCGCAGGCTACTA
CGCAGCACCGGAGAACTTCTACGACAACCAGGTCGACAAGACCCCAGCCG
CCAAGATAGCTGACAAGATCCAGGAGAACTTCAAGAACGCCTGCTTTGTG
GTGGTGGACAACAAACTGATGACGCTGCAGCACGACCGAGCCGCCATCCA
GGTATTCAACTGTCCCGGAGACTCTGGAGCAAGGTGGTCAAAGGCCAAGT
TTACGCTCTCACAGGCGTCCGATACATTGGAAGGCGTGTCGCTGCTGCTG
AAGCGCGGAGCCATGCGGGATTTGGTTGACTTTGACAACCATCTAGATAA
TCCGGACAAAAACTGGACCAACGACTTCCTGAATCAGCCGCTCAACGATC
TGCAGAAACTGTACTAGTCGTCCGTTTCAAACGTACGTTTTTTTTTTAGT
CTAGCAAAATCGCATTCGAGGGAACATGCCGGAATTTCAACCTTGCAATT
TAATTTATTGTAATTACATTTGGATTTCAGTAATCTTTAGAATAATGCAT
ATAAGTTAAATAACATTCAACTAATTAATAAATAATCAATTCTTTCATCA
TGAAAAAAAAAAAAAAAAAAA

SD01117.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:25:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG3501-RA 1165 CG3501-RA 157..958 1..802 4010 100 Plus
CG3501.a 1055 CG3501.a 157..558 1..402 2010 100 Plus
CG3501.a 1055 CG3501.a 555..895 462..802 1705 100 Plus
PIP5K59B-RA 3441 PIP5K59B-RA 3324..3441 802..685 590 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:35:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18767840..18768439 802..203 3000 100 Minus
chr2R 21145070 chr2R 18768920..18769122 203..1 1015 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:44:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22881322..22881921 802..203 3000 100 Minus
2R 25286936 2R 22882402..22882604 203..1 1015 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:02:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22882521..22883120 802..203 3000 100 Minus
2R 25260384 2R 22883601..22883803 203..1 1015 100 Minus
Blast to na_te.dros performed on 2019-03-16 04:35:12 has no hits.

SD01117.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:35:57 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18767840..18768438 204..802 100 <- Minus
chr2R 18768920..18769122 1..203 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:56:05 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 1..612 6..617 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:55:54 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 1..612 6..617 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:35:21 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 1..612 6..617 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:46:52 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 1..612 6..617 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:44:57 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 1..612 6..617 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:11:25 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 84..878 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:55:53 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 84..885 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:35:21 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 87..888 1..802 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:46:52 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 84..878 1..795 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:44:57 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
CG3501-RA 87..888 1..802 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:57 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22881322..22881920 204..802 100 <- Minus
2R 22882402..22882604 1..203 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:57 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22881322..22881920 204..802 100 <- Minus
2R 22882402..22882604 1..203 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:35:57 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22881322..22881920 204..802 100 <- Minus
2R 22882402..22882604 1..203 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:35:21 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18768845..18769443 204..802 100 <- Minus
arm_2R 18769925..18770127 1..203 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:02 Download gff for SD01117.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22882539..22883137 204..802 100 <- Minus
2R 22883619..22883821 1..203 100   Minus

SD01117.hyp Sequence

Translation from 2 to 616

> SD01117.hyp
KMCDYKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGSQVEIVDAIPL
FHQCLYVTPMAEVALMLIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAA
KIADKIQENFKNACFVVVDNKLMTLQHDRAAIQVFNCPGDSGARWSKAKF
TLSQASDTLEGVSLLLKRGAMRDLVDFDNHLDNPDKNWTNDFLNQPLNDL
QKLY*

SD01117.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:58:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG3501-PA 203 CG3501-PA 1..203 2..204 1064 100 Plus

SD01117.pep Sequence

Translation from 5 to 616

> SD01117.pep
MCDYKVSERAYAKLIFHAAKYPHQAVNGLLLAEKTSKGSQVEIVDAIPLF
HQCLYVTPMAEVALMLIDAHAEREGLVIAGYYAAPENFYDNQVDKTPAAK
IADKIQENFKNACFVVVDNKLMTLQHDRAAIQVFNCPGDSGARWSKAKFT
LSQASDTLEGVSLLLKRGAMRDLVDFDNHLDNPDKNWTNDFLNQPLNDLQ
KLY*

SD01117.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11322-PA 206 GF11322-PA 1..206 1..203 950 85 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20088-PA 203 GG20088-PA 1..203 1..203 1056 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20093-PA 202 GH20093-PA 1..202 1..203 831 73.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
EMC8-9-PA 203 CG3501-PA 1..203 1..203 1064 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18991-PA 202 GI18991-PA 1..202 1..203 849 76.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10198-PA 202 GL10198-PA 1..202 1..203 933 84.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17485-PA 202 GA17485-PA 1..202 1..203 934 84.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15604-PA 203 GM15604-PA 1..203 1..203 1081 99.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25100-PA 203 GD25100-PA 1..203 1..203 1081 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19954-PA 202 GJ19954-PA 1..202 1..203 846 75.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20856-PA 202 GK20856-PA 1..202 1..203 909 81.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11627-PA 203 GE11627-PA 1..203 1..203 1043 95.1 Plus