Clone SD01736 Report

Search the DGRC for SD01736

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:17
Well:36
Vector:pOT2
Associated Gene/TranscriptCG18324-RA
Protein status:SD01736.pep: gold
Preliminary Size:1479
Sequenced Size:1337

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18324 2001-01-01 Release 2 assignment
CG18324 2001-09-19 Blastp of sequenced clone
CG18324 2003-01-01 Sim4 clustering to Release 3
CG18324 2008-04-29 Release 5.5 accounting
CG18324 2008-08-15 Release 5.9 accounting
CG18324 2008-12-18 5.12 accounting

Clone Sequence Records

SD01736.complete Sequence

1337 bp (1337 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060454

> SD01736.complete
TTTCGTGCTGGGCGGAACGGCAGCGATGGGTGCGGTGGTGTTCACCAATC
CCATCGATGTGGTCAAGACGCGGATGCAGCTGCAGGGAGAGTTGGCTGCC
CGAGGAACCTATGTGAAGCCCTACAGGCATCTCCCCCAGGCCATGCTGCA
GATAGTCCTCAACGACGGACTCCTTGCTTTGGAGAAGGGTCTCGCTCCGG
CATTATGTTATCAATTTGTCCTCAACTCGGTCAGGCAAGTGCATTGTAAA
GGACACTTGTTGCCATCCATAAACATCAAAATCTTTGAACTTTATACGAA
TATTAGAGGTAGATTTAAACAAAGTTTATATAAAAGTGGCCGTAAAATTA
TGCAATGCTAAGTAGTGTAATTACAAGCACCATGAATTAATGTGAAATGC
ATGCTTATCTTATCTAACACTGTGAAGTAATGGACATTTAAGATAAGTCG
TTACGTTCATCATTGAAAATAGTTACCCTAAGCAAATTGCAGTGTAAATA
CCCTTTCCTTATGGTAGGCTAAGTGTATATTCGAACGCATTGGAGCTGGG
ATACTTGCAGAATGCGGATGGCTCCATATCCTTCTATCGGGGCATGTTCT
TTGGAGCTCTGGGCGGCTGCACGGGCACCTATTTCGCCAGCCCCTTCTAC
ATGATAAAGGCCCAACAGCATGCCCAGGCGGTTCAGTCCATTGCCGTAGG
CTTTCAGCACAAGCATACTTCGATGATGGATGCCCTGCTGCATATTTACC
GGACCAATGGCATTTCAGGATTCTGGCGCGCTGCTTTACCAAGCTTGAAC
CGAACGCTTGTGGCCTCCAGTGTACAGATCGGCACCTTTCCCAAAGCCAA
GTCCCTTCTGAAGGATAAAGGCTGGATCACCCATCCGGTTCTCCTCTCCT
TCTGTGCCGGCCTATCGTCGGGAACCCTTGTGGCAGTGGCCAATTCGCCC
TTTGATGTGCTCACCACACGGATGTACAACCAGCCAGTGGATGAAAAGGG
GCGTGGACTCATGTACAAGGGCTTGGTGGACTGTTTCACTAAAATCTGGA
GAACCGAAGGGATCCATGGGATGTACAAGGGCTTTTGGCCCATATACTTT
CGTAGTGCTCCACACACCACCTTGACATTTGTGTTTTTTGAAAAGTTGCT
CCATTTGCGAGATCGTTATGTTTTCTCCCAGCGCAGAAACTGAAGAGTCC
AGTCCTCATGGAGCCAACTAGATTACTGTAAATCCTCGCATACAATTGTT
AAGTCCCACGATGTGACAATCCTAAAATTTATAATTTTATAAATAATAAA
ATTGTTCATCAAAAATGAAAAAAAAAAAAAAAAAAAA

SD01736.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG18324-RA 1502 CG18324-RA 99..1416 1..1318 6590 100 Plus
CG18324-RB 1327 CG18324-RB 439..1241 516..1318 4015 100 Plus
CG18324-RB 1327 CG18324-RB 207..442 1..236 1180 100 Plus
CG8323.a 1373 CG8323.a 278..362 41..125 260 87 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10056878..10057542 653..1317 3325 100 Plus
chr2R 21145070 chr2R 10056179..10056831 1..653 3235 99.7 Plus
chr2R 21145070 chr2R 10052652..10052736 41..125 260 87.1 Plus
chr2R 21145070 chr2R 10054426..10054531 1..106 200 79.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:44:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14169569..14170234 653..1318 3330 100 Plus
2R 25286936 2R 14168870..14169522 1..653 3265 100 Plus
2R 25286936 2R 14165332..14165416 41..125 260 87.1 Plus
2R 25286936 2R 14167106..14167211 1..106 200 79.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14170768..14171433 653..1318 3330 100 Plus
2R 25260384 2R 14170069..14170721 1..653 3265 100 Plus
2R 25260384 2R 14166531..14166615 41..125 260 87 Plus
2R 25260384 2R 14168305..14168410 1..106 200 79.2 Plus
Blast to na_te.dros performed 2019-03-15 20:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2759..2824 1304..1236 113 65.2 Minus

SD01736.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:06:54 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10056179..10056831 1..653 99 -> Plus
chr2R 10056879..10057496 654..1271 100 <- Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:56:48 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RB 243..924 513..1193 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:58:07 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RB 243..924 513..1193 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:47:53 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RB 243..924 513..1193 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:27:21 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RB 243..924 513..1193 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:28:16 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RB 243..924 513..1193 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:44:46 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RA 1..1316 1..1316 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:58:07 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RA 1..1317 1..1317 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:47:53 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RA 85..1401 1..1317 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:27:21 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RA 1..1316 1..1316 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:28:16 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
CG18324-RA 85..1401 1..1317 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:06:54 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14168870..14169522 1..653 100 -> Plus
2R 14169570..14170233 654..1317 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:06:54 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14168870..14169522 1..653 100 -> Plus
2R 14169570..14170233 654..1317 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:06:54 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14168870..14169522 1..653 100 -> Plus
2R 14169570..14170233 654..1317 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:47:53 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10056375..10057027 1..653 100 -> Plus
arm_2R 10057075..10057738 654..1317 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:04:40 Download gff for SD01736.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14170069..14170721 1..653 100 -> Plus
2R 14170769..14171432 654..1317 100   Plus

SD01736.pep Sequence

Translation from 593 to 1192

> SD01736.pep
MFFGALGGCTGTYFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLH
IYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDKGWITHPVL
LSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTK
IWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHLRDRYVFSQRRN*

SD01736.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 22:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12030-PA 303 GF12030-PA 109..300 1..192 646 57.3 Plus
Dana\GF12029-PA 302 GF12029-PA 108..298 1..191 602 55.5 Plus
Dana\GF12031-PA 260 GF12031-PA 109..256 1..150 405 49.3 Plus
Dana\GF15593-PA 335 GF15593-PA 146..326 4..185 290 31.3 Plus
Dana\GF23354-PA 309 GF23354-PA 113..308 1..199 273 28.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 22:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20428-PA 307 GG20428-PA 109..307 1..199 995 90.5 Plus
Dere\GG20427-PA 304 GG20427-PA 109..300 1..192 630 55.2 Plus
Dere\GG20426-PA 303 GG20426-PA 109..300 1..192 569 52.1 Plus
Dere\GG25109-PA 337 GG25109-PA 148..332 4..189 300 31.2 Plus
Dere\GG25108-PA 335 GG25108-PA 149..326 7..185 296 32.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 22:41:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21842-PA 304 GH21842-PA 109..300 1..192 545 52.1 Plus
Dgri\GH11017-PA 333 GH11017-PA 144..324 4..185 287 30.8 Plus
Dgri\GH11016-PA 333 GH11016-PA 144..328 4..189 284 32.8 Plus
Dgri\GH23855-PA 333 GH23855-PA 144..328 4..189 282 32.3 Plus
Dgri\GH18903-PA 316 GH18903-PA 117..311 1..198 264 29 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG18324-PA 199 CG18324-PA 1..199 1..199 1062 100 Plus
CG18324-PB 307 CG18324-PB 109..307 1..199 1062 100 Plus
CG18327-PB 304 CG18327-PB 109..300 1..192 622 56.8 Plus
CG18327-PA 304 CG18327-PA 109..300 1..192 622 56.8 Plus
CG8323-PA 303 CG8323-PA 109..300 1..192 558 52.6 Plus
Ucp4C-PA 335 CG9064-PA 150..326 8..185 273 31.5 Plus
Ucp4B-PA 337 CG18340-PA 148..332 4..189 273 30.6 Plus
CG1907-PA 317 CG1907-PA 119..314 1..199 262 28.4 Plus
Ucp4A-PB 340 CG6492-PB 151..331 4..185 252 31.7 Plus
Ucp4A-PA 340 CG6492-PA 151..331 4..185 252 31.7 Plus
CG7514-PA 301 CG7514-PA 111..284 1..185 221 26.5 Plus
CG18418-PA 311 CG18418-PA 150..303 38..195 218 30.2 Plus
Bmcp-PB 303 CG7314-PB 121..300 5..185 197 27.6 Plus
Bmcp-PA 303 CG7314-PA 121..300 5..185 197 27.6 Plus
Dic1-PC 280 CG8790-PC 104..272 4..185 166 27.5 Plus
Dic1-PA 280 CG8790-PA 104..272 4..185 166 27.5 Plus
Dic1-PB 280 CG8790-PB 104..272 4..185 166 27.5 Plus
aralar1-PB 679 CG2139-PB 432..603 7..188 161 30.3 Plus
aralar1-PD 682 CG2139-PD 435..606 7..188 161 30.3 Plus
aralar1-PA 682 CG2139-PA 435..606 7..188 161 30.3 Plus
aralar1-PF 694 CG2139-PF 435..606 7..188 161 30.3 Plus
aralar1-PC 695 CG2139-PC 448..619 7..188 161 30.3 Plus
aralar1-PE 707 CG2139-PE 460..631 7..188 161 30.3 Plus
Dic3-PA 287 CG11196-PA 106..275 2..184 160 24.6 Plus
CG2616-PB 449 CG2616-PB 238..415 1..183 153 25.3 Plus
CG2616-PA 449 CG2616-PA 238..415 1..183 153 25.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 22:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19085-PA 307 GI19085-PA 109..300 1..192 573 54.2 Plus
Dmoj\GI17536-PA 334 GI17536-PA 145..325 4..185 295 31.9 Plus
Dmoj\GI23120-PA 315 GI23120-PA 116..306 1..194 270 31.1 Plus
Dmoj\GI17535-PA 338 GI17535-PA 147..333 2..189 255 28.7 Plus
Dmoj\GI15324-PA 379 GI15324-PA 188..370 2..185 249 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 22:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16987-PA 306 GL16987-PA 111..302 1..192 636 59.9 Plus
Dper\GL16985-PA 304 GL16985-PA 109..300 1..192 589 53.1 Plus
Dper\GL19094-PA 335 GL19094-PA 143..330 1..189 272 29.6 Plus
Dper\GL13895-PA 320 GL13895-PA 122..315 1..197 271 28.1 Plus
Dper\GL17935-PA 312 GL17935-PA 116..305 1..196 267 32 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 22:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14890-PB 307 GA14890-PB 112..303 1..192 636 59.9 Plus
Dpse\GA20987-PA 304 GA20987-PA 109..300 1..192 588 53.1 Plus
Dpse\GA15123-PA 320 GA15123-PA 122..315 1..197 270 28.1 Plus
Dpse\GA21513-PA 335 GA21513-PA 143..330 1..189 270 29.6 Plus
Dpse\GA20405-PA 312 GA20405-PA 116..305 1..196 267 32 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 22:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21515-PA 179 GM21515-PA 1..179 21..199 917 94.4 Plus
Dsec\GM21513-PA 304 GM21513-PA 109..300 1..192 640 55.7 Plus
Dsec\GM21512-PA 303 GM21512-PA 109..300 1..192 575 53.1 Plus
Dsec\GM18585-PA 335 GM18585-PA 149..326 7..185 293 31.3 Plus
Dsec\GM18586-PA 337 GM18586-PA 148..332 4..189 275 29.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 22:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11025-PA 307 GD11025-PA 109..307 1..199 1051 96 Plus
Dsim\GD11023-PA 303 GD11023-PA 109..300 1..192 576 53.1 Plus
Dsim\GD11024-PA 263 GD11024-PA 109..259 1..192 451 44.8 Plus
Dsim\GD23373-PA 335 GD23373-PA 149..326 7..185 294 31.3 Plus
Dsim\GD23374-PA 336 GD23374-PA 147..331 4..189 282 30.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 22:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20058-PA 308 GJ20058-PA 109..300 1..192 589 55.7 Plus
Dvir\GJ15433-PA 334 GJ15433-PA 145..325 4..185 313 32.4 Plus
Dvir\GJ15429-PA 332 GJ15429-PA 143..326 4..188 281 33 Plus
Dvir\GJ15435-PA 330 GJ15435-PA 139..330 2..194 251 28 Plus
Dvir\GJ10609-PA 315 GJ10609-PA 116..306 1..194 250 29.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 22:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22044-PA 306 GK22044-PA 112..303 1..192 616 56.8 Plus
Dwil\GK22254-PA 304 GK22254-PA 109..300 1..192 586 53.1 Plus
Dwil\GK11388-PA 303 GK11388-PA 109..303 1..194 580 53.8 Plus
Dwil\GK11904-PA 326 GK11904-PA 127..317 1..194 276 29.1 Plus
Dwil\GK14710-PA 365 GK14710-PA 176..356 4..185 265 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 22:41:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13559-PA 307 GE13559-PA 109..307 1..199 987 89.4 Plus
Dyak\GE13558-PA 304 GE13558-PA 109..300 1..192 647 57.3 Plus
Dyak\GE13557-PA 303 GE13557-PA 109..300 1..192 575 52.6 Plus
Dyak\GE25767-PA 335 GE25767-PA 149..326 7..185 291 31.3 Plus
Dyak\GE25777-PA 338 GE25777-PA 149..333 4..189 290 30.6 Plus

SD01736.hyp Sequence

Translation from 593 to 1192

> SD01736.hyp
MFFGALGGCTGTYFASPFYMIKAQQHAQAVQSIAVGFQHKHTSMMDALLH
IYRTNGISGFWRAALPSLNRTLVASSVQIGTFPKAKSLLKDKGWITHPVL
LSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDEKGRGLMYKGLVDCFTK
IWRTEGIHGMYKGFWPIYFRSAPHTTLTFVFFEKLLHLRDRYVFSQRRN*

SD01736.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG18324-PA 199 CG18324-PA 1..199 1..199 1062 100 Plus
CG18324-PB 307 CG18324-PB 109..307 1..199 1062 100 Plus
CG18327-PB 304 CG18327-PB 109..300 1..192 622 56.8 Plus
CG18327-PA 304 CG18327-PA 109..300 1..192 622 56.8 Plus
CG8323-PA 303 CG8323-PA 109..300 1..192 558 52.6 Plus