Clone SD02332 Report

Search the DGRC for SD02332

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:23
Well:32
Vector:pOT2
Associated Gene/TranscriptCG30382-RA
Protein status:SD02332.pep: gold
Preliminary Size:1089
Sequenced Size:971

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18495 2001-01-01 Release 2 assignment
CG30382 2003-01-01 Sim4 clustering to Release 3
CG18495 2003-01-01 Sim4 clustering to Release 3
CG18495 2003-01-14 Blastp of sequenced clone
CG30382 2008-04-29 Release 5.5 accounting
Prosalpha6 2008-08-15 Release 5.9 accounting
Prosalpha6 2008-12-18 5.12 accounting

Clone Sequence Records

SD02332.complete Sequence

971 bp (971 high quality bases) assembled on 2003-01-14

GenBank Submission: AY118637

> SD02332.complete
TGAATTTTGCACAGTAGGTTCGATTTGAAGCGACATTTTCCCTGCTATAT
ACAAATTTGTAAATTTTAATTGTTCAAAAGCTATCGAAGCACGAAGAAAG
CATCATGTCTCGCGGAAGTTCAGCCGGCTTTGACAGACACATCACGATCT
TCTCTCCGGAGGGACGCCTCTACCAAGTGGAGTACGCCTTCAAGGCTATT
GCCCAGGAGAACATCACCACGGTGGCGCTGAAGAGTGGCGACTGTGCCGT
GGTGGCCACCCAAAAAAAAGTGACCGAGAAGAACATCGTGCCTGAAACGG
TGACCCACCTGTTCCGCATCACCAAGGACATTGGATGCGCAATGACCGGA
CGCATAGCTGATTCCCGCTCACAGGTGCAGAAGGCCAGATACGAGGCCGC
CAACTTCCGCTACAAGTACGGCTACGAAATGCCCGTGGATGTGCTGTGTC
GTCGAATTGCGGATATCAACCAGGTGTACACGCAGAATGCCGAGATGCGT
CCGCTCGGCTGCAGCATGGTGCTGATCGCTTACGACAATGAAATCGGCCC
CAGCGTTTACAAGACGGACCCGGCTGGCTACTTCAGCGGGTTCAAGGCCT
GCAGCGTGGGTGCCAAGACTCTGGAGGCCAACAGCTATCTGGAAAAGAAG
TACAAGCCCAACTTGTCGGAGGAGAAAGCGATCCAGCTGGCCATCTCCTG
TCTGTCCAGTGTGCTCGCTATAGACTTCAAGCCGAACGGCATTGAGATCG
GCGTGGTCAGCAAGTCTGATCCCACTTTCCGTATTTTGGATGAGCGGGAG
ATCGAGGAACACCTCACCAAGATCGCCGAGAAGGACTAAGTTCTGTCCCG
CTAGCTGTAATTTTGTCATATTTTATAAAGCCTCTTGGATCTATGGTTAA
ATAAAAAATGCTCTTGGCTTGCATTCAAAACAAAGGCAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

SD02332.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG30382-RA 1127 CG30382-RA 191..1127 1..937 4685 100 Plus
Prosalpha1-RB 967 Prosalpha1-RB 31..967 1..937 4685 100 Plus
Prosalpha1-RA 885 Prosalpha1-RA 29..885 81..937 4285 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3714624..3715206 937..355 2915 100 Minus
chr2R 21145070 chr2R 3717734..3718316 937..355 2915 100 Minus
chr2R 21145070 chr2R 3715492..3715669 357..180 890 100 Minus
chr2R 21145070 chr2R 3718602..3718779 357..180 890 100 Minus
chr2R 21145070 chr2R 3715731..3715832 180..79 510 100 Minus
chr2R 21145070 chr2R 3718841..3718942 180..79 510 100 Minus
chr2R 21145070 chr2R 3715888..3715967 80..1 400 100 Minus
chr2R 21145070 chr2R 3718998..3719077 80..1 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:45:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7827300..7827885 940..355 2930 100 Minus
2R 25286936 2R 7830410..7830995 940..355 2930 100 Minus
2R 25286936 2R 7828171..7828348 357..180 890 100 Minus
2R 25286936 2R 7831281..7831458 357..180 890 100 Minus
2R 25286936 2R 7828410..7828511 180..79 510 100 Minus
2R 25286936 2R 7831520..7831621 180..79 510 100 Minus
2R 25286936 2R 7828567..7828646 80..1 400 100 Minus
2R 25286936 2R 7831677..7831756 80..1 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7831609..7832194 940..355 2930 100 Minus
2R 25260384 2R 7828499..7829084 940..355 2930 100 Minus
2R 25260384 2R 7832480..7832657 357..180 890 100 Minus
2R 25260384 2R 7829370..7829547 357..180 890 100 Minus
2R 25260384 2R 7832719..7832820 180..79 510 100 Minus
2R 25260384 2R 7829609..7829710 180..79 510 100 Minus
2R 25260384 2R 7829766..7829845 80..1 400 100 Minus
2R 25260384 2R 7832876..7832955 80..1 400 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:59:05 has no hits.

SD02332.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:59:46 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3714624..3715203 358..937 100 <- Minus
chr2R 3715492..3715668 181..357 100 <- Minus
chr2R 3715731..3715830 81..180 100 <- Minus
chr2R 3715888..3715967 1..80 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:57:36 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 1..735 105..839 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:42 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 1..735 105..839 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:04 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 1..735 105..839 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:35 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 1..735 105..839 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:16:37 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RB 1..735 105..839 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:33 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 14..950 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:42 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 14..950 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:04 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 16..952 1..937 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:35 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 14..950 1..937 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:16:37 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
CG30382-RA 16..952 1..937 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:46 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7828410..7828509 81..180 100 <- Minus
2R 7828567..7828646 1..80 100   Minus
2R 7828171..7828347 181..357 100 <- Minus
2R 7827303..7827882 358..937 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:46 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7828410..7828509 81..180 100 <- Minus
2R 7828567..7828646 1..80 100   Minus
2R 7828171..7828347 181..357 100 <- Minus
2R 7827303..7827882 358..937 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:59:46 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7828410..7828509 81..180 100 <- Minus
2R 7828567..7828646 1..80 100   Minus
2R 7828171..7828347 181..357 100 <- Minus
2R 7827303..7827882 358..937 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:04 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3715676..3715852 181..357 100 <- Minus
arm_2R 3715915..3716014 81..180 100 <- Minus
arm_2R 3716072..3716151 1..80 100   Minus
arm_2R 3714808..3715387 358..937 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:53 Download gff for SD02332.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7828502..7829081 358..937 100 <- Minus
2R 7829370..7829546 181..357 100 <- Minus
2R 7829609..7829708 81..180 100 <- Minus
2R 7829766..7829845 1..80 100   Minus

SD02332.pep Sequence

Translation from 104 to 838

> SD02332.pep
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVV
ATQKKVTEKNIVPETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAAN
FRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPS
VYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCL
SSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD*

SD02332.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11235-PA 244 GF11235-PA 1..244 1..244 1234 93.4 Plus
Dana\GF13142-PA 253 GF13142-PA 7..193 8..196 334 34.9 Plus
Dana\GF14761-PA 253 GF14761-PA 4..218 5..220 326 32.7 Plus
Dana\GF17957-PA 234 GF17957-PA 10..233 13..240 302 30.7 Plus
Dana\GF12213-PA 265 GF12213-PA 5..242 9..239 300 30.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:46:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10705-PA 244 GG10705-PA 1..244 1..244 1274 97.5 Plus
Dere\GG25255-PA 253 GG25255-PA 7..233 8..235 311 30.6 Plus
Dere\GG11887-PA 254 GG11887-PA 5..241 9..239 306 32.1 Plus
Dere\GG20675-PA 244 GG20675-PA 8..244 9..241 301 29.6 Plus
Dere\GG18927-PA 234 GG18927-PA 10..233 13..240 300 30.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20588-PA 244 GH20588-PA 1..244 1..244 1212 91.8 Plus
Dgri\GH24506-PA 214 GH24506-PA 4..210 30..236 564 51.2 Plus
Dgri\GH21393-PA 245 GH21393-PA 8..239 9..235 321 29.9 Plus
Dgri\GH21325-PA 253 GH21325-PA 7..179 8..181 314 34.5 Plus
Dgri\GH20521-PA 263 GH20521-PA 5..240 9..239 313 30.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha1-PB 244 CG18495-PB 1..244 1..244 1247 100 Plus
Prosalpha1-PA 244 CG18495-PA 1..244 1..244 1247 100 Plus
CG30382-PB 244 CG30382-PB 1..244 1..244 1247 100 Plus
CG30382-PA 244 CG30382-PA 1..244 1..244 1247 100 Plus
Prosalpha7-PA 253 CG1519-PA 7..240 8..242 317 30.5 Plus
Prosalpha3T-PA 251 CG1736-PA 5..235 9..233 316 34.9 Plus
Prosalpha5-PB 244 CG10938-PB 8..244 9..241 298 28.7 Plus
Prosalpha5-PA 244 CG10938-PA 8..244 9..241 298 28.7 Plus
Prosalpha3-PA 264 CG9327-PA 5..242 9..239 290 30.3 Plus
Prosalpha2-PA 234 CG5266-PA 10..233 13..240 285 30.7 Plus
Prosalpha6-PA 279 CG4904-PA 6..243 9..244 281 30.9 Plus
Prosalpha6-PB 279 CG4904-PB 6..243 9..244 281 30.9 Plus
Prosalpha4-PA 249 CG3422-PA 2..237 6..244 277 29 Plus
Prosalpha6T-PA 289 CG5648-PA 6..239 9..244 251 29.3 Plus
Prosalpha4T1-PA 249 CG17268-PA 2..237 6..244 250 27.4 Plus
Prosalpha4T2-PB 252 CG4569-PB 5..230 9..235 244 27.8 Plus
Prosalpha4T2-PA 252 CG4569-PA 5..230 9..235 244 27.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19734-PA 244 GI19734-PA 1..244 1..244 1204 91 Plus
Dmoj\GI16051-PA 247 GI16051-PA 2..239 5..242 578 45 Plus
Dmoj\GI20743-PA 253 GI20743-PA 7..231 8..232 328 31 Plus
Dmoj\GI24829-PA 234 GI24829-PA 10..233 13..240 311 31.1 Plus
Dmoj\GI21067-PA 263 GI21067-PA 5..240 9..239 311 31 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17442-PA 244 GL17442-PA 1..244 1..244 1244 94.3 Plus
Dper\GL12053-PA 181 GL12053-PA 1..167 1..169 507 56.2 Plus
Dper\GL10238-PA 254 GL10238-PA 7..194 8..196 329 33.3 Plus
Dper\GL10139-PA 262 GL10139-PA 5..240 9..239 322 31 Plus
Dper\GL22394-PA 246 GL22394-PA 5..238 9..243 314 30.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15805-PA 244 GA15805-PA 1..244 1..244 1244 94.3 Plus
Dpse\GA26178-PA 248 GA26178-PA 1..241 1..240 695 54.3 Plus
Dpse\GA24133-PA 254 GA24133-PA 7..194 8..196 329 33.3 Plus
Dpse\GA21704-PA 262 GA21704-PA 5..240 9..239 320 31 Plus
Dpse\GA25292-PA 249 GA25292-PA 2..237 6..244 318 32.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20751-PA 244 GM20751-PA 1..244 1..244 1289 98.8 Plus
Dsec\GM21770-PA 244 GM21770-PA 8..244 9..241 319 30 Plus
Dsec\GM24383-PA 253 GM24383-PA 7..240 8..242 314 30.5 Plus
Dsec\GM12106-PA 257 GM12106-PA 5..241 9..239 306 32.5 Plus
Dsec\GM15792-PA 264 GM15792-PA 5..242 9..239 301 30.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10216-PA 244 GD10216-PA 1..244 1..244 1289 98.8 Plus
Dsim\GD11263-PA 244 GD11263-PA 8..244 9..241 316 30 Plus
Dsim\GD10046-PA 253 GD10046-PA 7..240 8..242 314 30.5 Plus
Dsim\GD16600-PA 257 GD16600-PA 5..241 9..239 314 31 Plus
Dsim\GD11553-PA 264 GD11553-PA 5..242 9..239 301 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18434-PA 244 GJ18434-PA 1..244 1..244 1178 88.9 Plus
Dvir\GJ15627-PA 247 GJ15627-PA 1..240 1..240 804 59.2 Plus
Dvir\GJ20367-PA 245 GJ20367-PA 8..244 9..240 325 29.7 Plus
Dvir\GJ20480-PA 252 GJ20480-PA 7..219 8..220 317 31.8 Plus
Dvir\GJ24473-PA 234 GJ24473-PA 10..233 13..240 310 30.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21354-PA 244 GK21354-PA 1..244 1..244 1212 90.6 Plus
Dwil\GK21413-PA 245 GK21413-PA 8..245 9..241 322 29.5 Plus
Dwil\GK22956-PA 262 GK22956-PA 5..240 9..239 320 31.8 Plus
Dwil\GK14404-PA 234 GK14404-PA 10..233 13..240 316 32 Plus
Dwil\GK20963-PA 256 GK20963-PA 7..179 8..181 298 34.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23574-PA 244 GE23574-PA 1..244 1..244 1272 96.7 Plus
Dyak\GE21995-PA 253 GE21995-PA 7..233 8..235 310 30.6 Plus
Dyak\GE26194-PA 234 GE26194-PA 10..233 13..240 305 31.1 Plus
Dyak\GE12155-PA 264 GE12155-PA 5..242 9..239 301 30.3 Plus
Dyak\GE23336-PA 253 GE23336-PA 5..241 9..239 297 30.4 Plus

SD02332.hyp Sequence

Translation from 104 to 838

> SD02332.hyp
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAIAQENITTVALKSGDCAVV
ATQKKVTEKNIVPETVTHLFRITKDIGCAMTGRIADSRSQVQKARYEAAN
FRYKYGYEMPVDVLCRRIADINQVYTQNAEMRPLGCSMVLIAYDNEIGPS
VYKTDPAGYFSGFKACSVGAKTLEANSYLEKKYKPNLSEEKAIQLAISCL
SSVLAIDFKPNGIEIGVVSKSDPTFRILDEREIEEHLTKIAEKD*

SD02332.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:39
Subject Length Description Subject Range Query Range Score Percent Strand
Prosalpha1-PB 244 CG18495-PB 1..244 1..244 1247 100 Plus
Prosalpha1-PA 244 CG18495-PA 1..244 1..244 1247 100 Plus
CG30382-PB 244 CG30382-PB 1..244 1..244 1247 100 Plus
CG30382-PA 244 CG30382-PA 1..244 1..244 1247 100 Plus
Prosalpha7-PA 253 CG1519-PA 7..240 8..242 317 30.5 Plus