Clone SD03412 Report

Search the DGRC for SD03412

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:34
Well:12
Vector:pOT2
Associated Gene/TranscriptCG30059-RA
Protein status:SD03412.pep: gold
Preliminary Size:1717
Sequenced Size:1703

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18278 2001-01-01 Release 2 assignment
CG30059 2001-10-10 Blastp of sequenced clone
CG30059 2003-01-01 Sim4 clustering to Release 3
CG30059 2008-04-29 Release 5.5 accounting
CG30059 2008-08-15 Release 5.9 accounting
CG30059 2008-12-18 5.12 accounting

Clone Sequence Records

SD03412.complete Sequence

1703 bp (1703 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061585

> SD03412.complete
TGCAAGCCGGGCTTTGTTATCGCACAAATTTTATGTAAACAAAAGAAAAC
TTCGATCTGCTCCATGATCACCTTAGCCCCTCTGATCGTCCTAGTCCTCG
CTTGCCTGGGAAACACGGCCAGCGAGAAGTTGCCCAACATTCTGCTGATC
CTGTCCGACGATCAGGATGTGGAGCTGCGCGGTATGTTTCCCATGGAGCA
TACGATCGAAATGCTGGGTTTCGGTGGCGCCCTGTTCCACAACGCCTACA
CGCCCTCGCCCATCTGCTGTCCGGCGAGGACGAGTCTGCTGACGGGCATG
TATGCGCACAATCACGGCACCCGGAACAATTCCGTAAGTGGTGGATGCTA
CGGACCGCACTGGCGGCGTGCCCTGGAGCCCCGGGCTTTGCCATACATCT
TGCAGCAGCACGGATACAACACCTTCTTTGGCGGGAAGTACTTGAATCAG
TACTGGGGCGCTGGGGATGTGCCAAAGGGTTGGAATAACTTCTACGGCCT
TCACGGGAACTCTAGATACTATAACTACACACTGCGCGAAAATACCGGCA
ACGTGCACTACGAGTCGACCTACCTATCCGATCTGCTAAGAGATCGCGCC
GCTGACTTTCTAAGAAATGCTACACAATCCTCGGAACCGTTCTTCGCGAT
GGTCGCCCCACCGGCAGCCCATGAACCCTTCACTCCGGCACCAAGACATG
AGGGTGTGTTCTCCCATATCGAAGCCCTGCGCACACCCAGCTTCAATCAA
GTTAAGCAGGATAAGCACTGGTTGGTGCGAGCAGCACGTCGTCTGCCCAA
CGAAACCATCAACACCATAGACACGTATTTCCAGAAACGCTGGGAAACGC
TGCTGGCCGTGGACGAACTGGTCGTCACCTTGATGGGAGTGCTAAACGAT
ACGCAATCGTTGGAGAACACCTACATTATCTACACCTCGGATAACGGCTA
CCATGTGGGGCAGTTTGCACAGCCCTTCGATAAGAGACAGCCCTACGAAA
CGGATATTAACGTACCGCTGCTAATCCGGGGACCTGGAATAGCACCTGAG
AGCCACATTGACACTGCCGTCAGTCTAGTGGACTTGGCACCGACTATATT
GGCCTGGGCCGACATCGACACACCATCCTACATGGATGGGCAATCATTTC
ACGAGCTTTTGCTCAACAAAAGGCGAAGGGTTCCATTTTTCGAGCGTTCC
CTGTTGATCGAGTACTGGGGCGAGGGAACTCTGGCCACCTTTAATCCTGA
ATGCCCTTGGCCAGAAAAGGATCGATTGGCGCAGTGCACCCCCGCAGCGG
ATTGCCATTGCCAGGATGCATGGAACAACACCTACGCCTGCTTAAGAAAT
ATTCGCCATCGCGAGGATCGCATTTACTGCGAATTTCGGGATAACGAGAA
CTTTTTGGAGGCATATGACCTGCAACTGGATCCCTTTCAAATGACCAACA
TTGCCTACGATCTGCTGCCCATTGAACGAGCTTTGTATTCGTTGCGTCTC
AAGAATCTCACACAGTGTTCGGGCCACTCGTGTTTTGTATAGATATATGC
ATATTACTCCTAGCCAAATAGTAATCCAAAACCAAATTCAAGTCCGCTGG
GCGCATATAGATTTCATATTCAGATATCATGTGATTTATGTTGCTATATA
CATAGTCTCATATTAATCGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

SD03412.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:11:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG30059-RA 1687 CG30059-RA 18..1687 1..1670 8350 100 Plus
CG18278-RA 1743 CG18278-RA 74..1743 1..1670 8140 99.1 Plus
CG33470-RA 910 CG33470-RA 848..910 1671..1609 315 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:21:36
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9301137..9301836 765..66 3455 99.6 Minus
chr2R 21145070 chr2R 9296410..9297109 765..66 3275 97.9 Minus
chr2R 21145070 chr2R 9295720..9296358 1398..760 3195 100 Minus
chr2R 21145070 chr2R 9300447..9301085 1398..760 3195 100 Minus
chr2R 21145070 chr2R 9295389..9295662 1670..1397 1370 100 Minus
chr2R 21145070 chr2R 9300116..9300389 1670..1397 1370 100 Minus
chr2R 21145070 chr2R 9297162..9297227 66..1 330 100 Minus
chr2R 21145070 chr2R 9301889..9301954 66..1 330 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:47:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:21:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13413790..13414489 765..66 3485 99.9 Minus
2R 25286936 2R 13409063..13409762 765..66 3275 97.9 Minus
2R 25286936 2R 13408373..13409011 1398..760 3195 100 Minus
2R 25286936 2R 13413100..13413738 1398..760 3195 100 Minus
2R 25286936 2R 13408041..13408315 1671..1397 1375 100 Minus
2R 25286936 2R 13412768..13413042 1671..1397 1375 100 Minus
2R 25286936 2R 13409815..13409880 66..1 330 100 Minus
2R 25286936 2R 13414542..13414607 66..1 330 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13414989..13415688 765..66 3485 99.8 Minus
2R 25260384 2R 13410262..13410961 765..66 3275 97.8 Minus
2R 25260384 2R 13414299..13414937 1398..760 3195 100 Minus
2R 25260384 2R 13409572..13410210 1398..760 3195 100 Minus
2R 25260384 2R 13413967..13414241 1671..1397 1375 100 Minus
2R 25260384 2R 13409240..13409514 1671..1397 1375 100 Minus
2R 25260384 2R 13415741..13415806 66..1 330 100 Minus
2R 25260384 2R 13411014..13411079 66..1 330 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:21:35 has no hits.

SD03412.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:22:45 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9300116..9300387 1399..1670 100 <- Minus
chr2R 9300447..9301084 761..1398 100 <- Minus
chr2R 9301142..9301835 67..760 99 <- Minus
chr2R 9301889..9301954 1..66 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:59:00 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 1..1479 64..1542 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:50:42 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 1..1479 64..1542 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:25:59 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 1..1479 64..1542 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:19:49 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 1..1479 64..1542 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:30:25 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 1..1479 64..1542 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:35:24 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 1..1668 1..1668 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:50:42 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 8..1677 1..1670 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:25:59 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 14..1683 1..1670 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:19:49 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 1..1668 1..1668 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:30:25 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
CG30059-RA 14..1683 1..1670 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:22:45 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13412769..13413040 1399..1670 100 <- Minus
2R 13413100..13413737 761..1398 100 <- Minus
2R 13413795..13414488 67..760 100 <- Minus
2R 13414542..13414607 1..66 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:22:45 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13412769..13413040 1399..1670 100 <- Minus
2R 13413100..13413737 761..1398 100 <- Minus
2R 13413795..13414488 67..760 100 <- Minus
2R 13414542..13414607 1..66 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:22:45 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13412769..13413040 1399..1670 100 <- Minus
2R 13413100..13413737 761..1398 100 <- Minus
2R 13413795..13414488 67..760 100 <- Minus
2R 13414542..13414607 1..66 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:25:59 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9300274..9300545 1399..1670 100 <- Minus
arm_2R 9300605..9301242 761..1398 100 <- Minus
arm_2R 9301300..9301993 67..760 100 <- Minus
arm_2R 9302047..9302112 1..66 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:56:29 Download gff for SD03412.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13413968..13414239 1399..1670 100 <- Minus
2R 13414299..13414936 761..1398 100 <- Minus
2R 13414994..13415687 67..760 100 <- Minus
2R 13415741..13415806 1..66 100   Minus

SD03412.hyp Sequence

Translation from 0 to 1541

> SD03412.hyp
CKPGFVIAQILCKQKKTSICSMITLAPLIVLVLACLGNTASEKLPNILLI
LSDDQDVELRGMFPMEHTIEMLGFGGALFHNAYTPSPICCPARTSLLTGM
YAHNHGTRNNSVSGGCYGPHWRRALEPRALPYILQQHGYNTFFGGKYLNQ
YWGAGDVPKGWNNFYGLHGNSRYYNYTLRENTGNVHYESTYLSDLLRDRA
ADFLRNATQSSEPFFAMVAPPAAHEPFTPAPRHEGVFSHIEALRTPSFNQ
VKQDKHWLVRAARRLPNETINTIDTYFQKRWETLLAVDELVVTLMGVLND
TQSLENTYIIYTSDNGYHVGQFAQPFDKRQPYETDINVPLLIRGPGIAPE
SHIDTAVSLVDLAPTILAWADIDTPSYMDGQSFHELLLNKRRRVPFFERS
LLIEYWGEGTLATFNPECPWPEKDRLAQCTPAADCHCQDAWNNTYACLRN
IRHREDRIYCEFRDNENFLEAYDLQLDPFQMTNIAYDLLPIERALYSLRL
KNLTQCSGHSCFV*

SD03412.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30059-PA 492 CG30059-PA 1..492 22..513 2682 100 Plus
CG18278-PA 492 CG18278-PA 1..492 22..513 2665 99 Plus
Sulf1-PC 1114 CG6725-PC 47..407 38..394 687 40.9 Plus
Sulf1-PB 1114 CG6725-PB 47..407 38..394 687 40.9 Plus
Sulf1-PA 1114 CG6725-PA 47..407 38..394 687 40.9 Plus

SD03412.pep Sequence

Translation from 63 to 1541

> SD03412.pep
MITLAPLIVLVLACLGNTASEKLPNILLILSDDQDVELRGMFPMEHTIEM
LGFGGALFHNAYTPSPICCPARTSLLTGMYAHNHGTRNNSVSGGCYGPHW
RRALEPRALPYILQQHGYNTFFGGKYLNQYWGAGDVPKGWNNFYGLHGNS
RYYNYTLRENTGNVHYESTYLSDLLRDRAADFLRNATQSSEPFFAMVAPP
AAHEPFTPAPRHEGVFSHIEALRTPSFNQVKQDKHWLVRAARRLPNETIN
TIDTYFQKRWETLLAVDELVVTLMGVLNDTQSLENTYIIYTSDNGYHVGQ
FAQPFDKRQPYETDINVPLLIRGPGIAPESHIDTAVSLVDLAPTILAWAD
IDTPSYMDGQSFHELLLNKRRRVPFFERSLLIEYWGEGTLATFNPECPWP
EKDRLAQCTPAADCHCQDAWNNTYACLRNIRHREDRIYCEFRDNENFLEA
YDLQLDPFQMTNIAYDLLPIERALYSLRLKNLTQCSGHSCFV*

SD03412.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11188-PA 501 GF11188-PA 8..501 4..492 1821 67.4 Plus
Dana\GF16526-PA 1145 GF16526-PA 52..431 17..391 669 40.2 Plus
Dana\GF13402-PA 541 GF13402-PA 1..376 1..392 208 24.7 Plus
Dana\GF25237-PA 570 GF25237-PA 1..357 1..352 197 24.8 Plus
Dana\GF16526-PA 1145 GF16526-PA 965..1041 414..492 162 43 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:21:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22495-PA 492 GG22495-PA 1..492 1..492 2548 93.9 Plus
Dere\GG20070-PA 1115 GG20070-PA 47..427 16..391 676 40.1 Plus
Dere\GG20328-PA 478 GG20328-PA 6..375 7..392 199 23.9 Plus
Dere\GG15780-PA 565 GG15780-PA 21..363 18..359 187 24.9 Plus
Dere\GG19815-PA 565 GG19815-PA 21..363 18..359 185 24.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12546-PA 501 GH12546-PA 7..501 9..492 1605 59.9 Plus
Dgri\GH18078-PA 1191 GH18078-PA 74..453 17..391 670 40.5 Plus
Dgri\GH14468-PA 619 GH14468-PA 29..369 20..359 218 26.7 Plus
Dgri\GH22700-PA 542 GH22700-PA 19..360 6..367 205 25.4 Plus
Dgri\GH14469-PA 560 GH14469-PA 29..369 20..359 203 25.1 Plus
Dgri\GH18078-PA 1191 GH18078-PA 1013..1089 414..492 158 41.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG30059-PA 492 CG30059-PA 1..492 1..492 2682 100 Plus
CG18278-PA 492 CG18278-PA 1..492 1..492 2665 99 Plus
Sulf1-PC 1114 CG6725-PC 47..407 17..373 687 40.9 Plus
Sulf1-PB 1114 CG6725-PB 47..407 17..373 687 40.9 Plus
Sulf1-PA 1114 CG6725-PA 47..407 17..373 687 40.9 Plus
CG8646-PB 562 CG8646-PB 6..394 7..391 213 24.1 Plus
CG32191-PC 564 CG32191-PC 8..357 10..355 199 25.3 Plus
CG32191-PB 564 CG32191-PB 8..357 10..355 199 25.3 Plus
CG7408-PD 585 CG7408-PD 15..297 4..295 169 23.4 Plus
CG7408-PC 585 CG7408-PC 15..297 4..295 169 23.4 Plus
CG7408-PB 585 CG7408-PB 15..297 4..295 169 23.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14019-PA 493 GI14019-PA 3..491 7..492 1649 61.3 Plus
Dmoj\GI24652-PA 1155 GI24652-PA 61..436 16..386 680 40.6 Plus
Dmoj\GI18487-PA 528 GI18487-PA 21..314 24..348 181 24.3 Plus
Dmoj\GI24623-PA 528 GI24623-PA 27..353 25..366 171 25 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:21:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10403-PA 499 GL10403-PA 5..499 1..492 1813 68.8 Plus
Dper\GL22250-PA 1173 GL22250-PA 61..440 17..391 672 40.5 Plus
Dper\GL11077-PA 545 GL11077-PA 26..356 24..368 196 24.6 Plus
Dper\GL22750-PA 575 GL22750-PA 37..370 24..358 196 25.9 Plus
Dper\GL22855-PA 559 GL22855-PA 15..335 11..355 153 23.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:21:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24970-PB 499 GA24970-PB 5..499 1..492 1820 69 Plus
Dpse\GA19814-PA 1160 GA19814-PA 60..439 17..391 672 40.5 Plus
Dpse\GA16747-PA 575 GA16747-PA 37..370 24..358 202 25.8 Plus
Dpse\GA21235-PA 545 GA21235-PA 26..356 24..368 196 24.6 Plus
Dpse\GA23896-PA 577 GA23896-PA 15..357 11..355 173 24.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20282-PA 492 GM20282-PA 1..492 1..492 2607 97.2 Plus
Dsec\GM15446-PA 1114 GM15446-PA 47..426 17..391 677 40.5 Plus
Dsec\GM21416-PA 542 GM21416-PA 6..375 7..392 217 23.9 Plus
Dsec\GM24306-PA 554 GM24306-PA 20..363 17..359 188 23.5 Plus
Dsec\GM18674-PA 524 GM18674-PA 7..335 8..355 159 26.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25763-PA 1772 GD25763-PA 1..405 41..445 2263 97 Plus
Dsim\GD20299-PA 1114 GD20299-PA 47..426 17..391 677 40.5 Plus
Dsim\GD10911-PA 633 GD10911-PA 6..375 7..392 208 23.6 Plus
Dsim\GD12374-PA 554 GD12374-PA 20..363 17..359 195 23.8 Plus
Dsim\GD20144-PA 439 GD20144-PA 7..335 8..355 169 27 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19791-PA 500 GJ19791-PA 1..498 1..490 1714 63.5 Plus
Dvir\GJ23505-PA 1135 GJ23505-PA 61..441 16..391 669 40.3 Plus
Dvir\GJ21349-PA 531 GJ21349-PA 21..322 24..346 201 26.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10744-PA 505 GK10744-PA 33..503 23..490 1710 66.3 Plus
Dwil\GK13512-PA 1148 GK13512-PA 50..430 16..391 674 40.4 Plus
Dwil\GK11604-PA 567 GK11604-PA 13..357 9..354 220 26.3 Plus
Dwil\GK20325-PA 550 GK20325-PA 1..355 1..354 188 25.1 Plus
Dwil\GK13512-PA 1148 GK13512-PA 965..1041 414..492 154 41.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13365-PA 492 GE13365-PA 1..492 1..492 2539 93.9 Plus
Dyak\GE26324-PA 1108 GE26324-PA 46..426 16..391 678 40.4 Plus
Dyak\GE12487-PA 544 GE12487-PA 6..375 7..392 201 24.2 Plus
Dyak\GE22117-PA 565 GE22117-PA 21..363 18..359 191 24.4 Plus