Clone SD03837 Report

Search the DGRC for SD03837

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:38
Well:37
Vector:pOT2
Associated Gene/Transcriptregucalcin-RA
Protein status:SD03837.pep: gold
Preliminary Size:1264
Sequenced Size:1108

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1803 2001-01-01 Release 2 assignment
CG1803 2002-05-15 Blastp of sequenced clone
CG1803 2003-01-01 Sim4 clustering to Release 3
regucalcin 2008-04-29 Release 5.5 accounting
regucalcin 2008-08-15 Release 5.9 accounting
regucalcin 2008-12-18 5.12 accounting

Clone Sequence Records

SD03837.complete Sequence

1108 bp (1108 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118643

> SD03837.complete
CGGAGCCGTGTCCAAGGATTCTCGATTCTCTATTCTCGATTCCCCATCTC
TCAGCTCAAGCTTAAGCTATCTCCAAGATGTCGTACAAGGTGGAACCATT
GCCCGATTCCTACGCCGGCCTGGGCGAGGGTCCCCATTGGGATGTGGCCA
GGCAAAGCCTGTACTACGTGGATTTGGAGGCGGGCAGCCTGCTCCGCTAC
GACTATGCCCAGAACAAGGTCTACAAGACGAAGATCGAGGGCGAAACCTT
GGCCGGATTCGTGCTGCCGGTGGAGGGACGTCCGCAGGAGTTCGCCGTCG
GCTGCGGTCGACGCGTGGTGATCGTCAACTGGGATGGCGTCTCGCCCAGC
GCCAAGGTGGTGCGCACACTGTTCGAGGTGCAGCCACTGATGGAGAAGAA
TCGTTTGAACGACGCCAAGGTTGATCCCCGTGGTCGCTTCTTTGGCGGCA
CCATGCGCTACATTGGCGATGAGTTCGAGTTCCGTCACGGCGAGCTGTAC
CGCTGGGAGGCCGGTGGCCAGGTGTCGGTGATCAAGGGCGATGTGGGCAT
CTCCAATGGACTGGCATGGGACGAGAAGGCCAAGAAGTTCTACTACATCG
ATACCACCGACTACGAGGTGAAGTCGTATGACTATGATTTCGAGACCGGC
GTGGCTAGCAATCCCAAGGTTATATTCAATCTGCGCAAGAACAGTCCCAA
GGATCATCTGCTGCCCGATGGCCTGACCATCGATACCGAGGGCAACCTGT
ATGTGGCCACCTTCAATGGCGCCACCATCTACAAGGTTAATCCCAACACT
GGCAAGATTCTGCTTGAGATCAAGTTCCCAACCAAACAGATTACCTCCGC
CGCCTTCGGTGGCCCCAACTTGGACATCCTGTACGTGACCACTGCCGCCA
AGTTCGATCAGCCCGCTCCAGCTGGCACCACCTACAAGGTGACCGGACTG
AACGCCACCGGCTATCCCGGCGTCAACCTGAAGGTCTAGGAGCTGCAATC
TCTATCTATCCTTAGCCGCAGTAAAATGTACCAATCGAATCCAAGTGCAA
TTATATGTTATGCTCTTTAACGTTTTAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

SD03837.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:54
Subject Length Description Subject Range Query Range Score Percent Strand
regucalcin-RC 1459 regucalcin-RC 74..1152 1..1079 5305 99.4 Plus
regucalcin.a 1426 regucalcin.a 114..1119 74..1079 4940 99.4 Plus
regucalcin-RD 1282 regucalcin-RD 87..1089 77..1079 4925 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11907066..11907786 76..796 3605 100 Plus
chrX 22417052 chrX 11907844..11908123 797..1076 1400 100 Plus
chr3R 27901430 chr3R 10571165..10571882 793..76 455 70.9 Minus
chrX 22417052 chrX 11905518..11905594 1..77 385 100 Plus
chr3R 27901430 chr3R 10570911..10571103 989..797 260 75.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:47:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 12016001..12016721 76..796 3515 99.2 Plus
X 23542271 X 12016779..12017061 797..1079 1415 100 Plus
3R 32079331 3R 14746410..14747127 793..76 455 70.9 Minus
X 23542271 X 12014445..12014521 1..77 385 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 12024099..12024819 76..796 3515 99.1 Plus
X 23527363 X 12024877..12025159 797..1079 1415 100 Plus
X 23527363 X 12022543..12022619 1..77 385 100 Plus
3R 31820162 3R 14487862..14487958 172..76 245 83.5 Minus
3R 31820162 3R 14487415..14487491 619..543 220 85.7 Minus
3R 31820162 3R 14487241..14487317 793..717 175 81.8 Minus
Blast to na_te.dros performed on 2019-03-16 14:52:00 has no hits.

SD03837.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:52:53 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11905518..11905594 1..77 100 -> Plus
chrX 11907068..11907786 78..796 100 -> Plus
chrX 11907844..11908123 797..1076 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:59:24 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RD 48..960 77..989 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:11 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RD 48..960 77..989 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:01:41 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RD 48..960 77..989 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:49 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RD 48..960 77..989 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:34:11 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RD 48..960 77..989 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:54 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RC 27..1102 1..1076 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:11 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RC 27..1102 1..1076 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:01:41 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RC 22..1097 1..1076 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:49 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RC 27..1102 1..1076 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:34:11 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
regucalcin-RC 22..1097 1..1076 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:52:53 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
X 12016779..12017058 797..1076 100   Plus
X 12014445..12014521 1..77 100 -> Plus
X 12016003..12016721 78..796 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:52:53 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
X 12016779..12017058 797..1076 100   Plus
X 12014445..12014521 1..77 100 -> Plus
X 12016003..12016721 78..796 99 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:52:53 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
X 12016779..12017058 797..1076 100   Plus
X 12014445..12014521 1..77 100 -> Plus
X 12016003..12016721 78..796 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:01:41 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11908478..11908554 1..77 100 -> Plus
arm_X 11910036..11910754 78..796 99 -> Plus
arm_X 11910812..11911091 797..1076 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:06 Download gff for SD03837.complete
Subject Subject Range Query Range Percent Splice Strand
X 12024101..12024819 78..796 99 -> Plus
X 12024877..12025156 797..1076 100   Plus
X 12022543..12022619 1..77 100 -> Plus

SD03837.hyp Sequence

Translation from 77 to 988

> SD03837.hyp
MSYKVEPLPDSYAGLGEGPHWDVARQSLYYVDLEAGSLLRYDYAQNKVYK
TKIEGETLAGFVLPVEGRPQEFAVGCGRRVVIVNWDGVSPSAKVVRTLFE
VQPLMEKNRLNDAKVDPRGRFFGGTMRYIGDEFEFRHGELYRWEAGGQVS
VIKGDVGISNGLAWDEKAKKFYYIDTTDYEVKSYDYDFETGVASNPKVIF
NLRKNSPKDHLLPDGLTIDTEGNLYVATFNGATIYKVNPNTGKILLEIKF
PTKQITSAAFGGPNLDILYVTTAAKFDQPAPAGTTYKVTGLNATGYPGVN
LKV*

SD03837.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
regucalcin-PB 303 CG1803-PB 1..303 1..303 1606 100 Plus
regucalcin-PC 303 CG1803-PC 1..303 1..303 1606 100 Plus
regucalcin-PA 303 CG1803-PA 1..303 1..303 1606 100 Plus
regucalcin-PD 319 CG1803-PD 17..319 1..303 1606 100 Plus
smp-30-PD 303 CG7390-PD 1..303 1..303 1173 71.9 Plus

SD03837.pep Sequence

Translation from 77 to 988

> SD03837.pep
MSYKVEPLPDSYAGLGEGPHWDVARQSLYYVDLEAGSLLRYDYAQNKVYK
TKIEGETLAGFVLPVEGRPQEFAVGCGRRVVIVNWDGVSPSAKVVRTLFE
VQPLMEKNRLNDAKVDPRGRFFGGTMRYIGDEFEFRHGELYRWEAGGQVS
VIKGDVGISNGLAWDEKAKKFYYIDTTDYEVKSYDYDFETGVASNPKVIF
NLRKNSPKDHLLPDGLTIDTEGNLYVATFNGATIYKVNPNTGKILLEIKF
PTKQITSAAFGGPNLDILYVTTAAKFDQPAPAGTTYKVTGLNATGYPGVN
LKV*

SD03837.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19376-PA 303 GF19376-PA 1..303 1..303 1514 92.7 Plus
Dana\GF18130-PA 577 GF18130-PA 274..577 1..303 1119 69.1 Plus
Dana\GF18129-PA 305 GF18129-PA 2..305 1..303 1106 69.1 Plus
Dana\GF18130-PA 577 GF18130-PA 1..275 1..289 843 56.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:33:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17702-PA 318 GG17702-PA 16..318 1..303 1590 99 Plus
Dere\GG21077-PA 303 GG21077-PA 1..303 1..303 1169 72.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:33:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24165-PA 421 GH24165-PA 119..421 1..303 1425 86.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
regucalcin-PD 319 CG1803-PD 17..319 1..303 1606 100 Plus
regucalcin-PB 303 CG1803-PB 1..303 1..303 1606 100 Plus
regucalcin-PC 303 CG1803-PC 1..303 1..303 1606 100 Plus
regucalcin-PA 303 CG1803-PA 1..303 1..303 1606 100 Plus
smp-30-PD 303 CG7390-PD 1..303 1..303 1173 71.9 Plus
smp-30-PB 303 CG7390-PB 1..303 1..303 1173 71.9 Plus
smp-30-PA 303 CG7390-PA 1..303 1..303 1173 71.9 Plus
smp-30-PC 306 CG7390-PC 4..306 1..303 1173 71.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21765-PA 334 GI21765-PA 32..334 1..303 1410 86.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:33:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20270-PA 287 GL20270-PA 23..286 1..302 1183 77.2 Plus
Dper\GL23668-PA 303 GL23668-PA 1..303 1..303 1179 71.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14770-PA 325 GA14770-PA 23..324 1..302 1503 92.1 Plus
Dpse\GA26692-PA 303 GA26692-PA 1..303 1..303 1179 71.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:34:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13249-PA 315 GM13249-PA 22..315 10..303 1527 97.3 Plus
Dsec\GM25827-PA 303 GM25827-PA 1..303 1..303 1166 71.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:34:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17058-PA 348 GD17058-PA 46..348 1..303 1585 98.7 Plus
Dsim\GD20401-PA 303 GD20401-PA 4..302 1..299 1150 71.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18538-PA 303 GJ18538-PA 1..303 1..303 1443 88.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:34:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10081-PA 303 GK10081-PA 1..303 1..303 1430 86.1 Plus
Dwil\GK11687-PA 601 GK11687-PA 1..303 1..303 1250 76.6 Plus
Dwil\GK11687-PA 601 GK11687-PA 299..601 1..303 1155 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:34:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\regucalcin-PA 318 GE16489-PA 16..318 1..303 1580 98 Plus
Dyak\smp-30-PA 757 GE26429-PA 455..757 1..303 1194 72.3 Plus