BDGP Sequence Production Resources |
Search the DGRC for SD03837
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 38 |
Well: | 37 |
Vector: | pOT2 |
Associated Gene/Transcript | regucalcin-RA |
Protein status: | SD03837.pep: gold |
Preliminary Size: | 1264 |
Sequenced Size: | 1108 |
Gene | Date | Evidence |
---|---|---|
CG1803 | 2001-01-01 | Release 2 assignment |
CG1803 | 2002-05-15 | Blastp of sequenced clone |
CG1803 | 2003-01-01 | Sim4 clustering to Release 3 |
regucalcin | 2008-04-29 | Release 5.5 accounting |
regucalcin | 2008-08-15 | Release 5.9 accounting |
regucalcin | 2008-12-18 | 5.12 accounting |
1108 bp (1108 high quality bases) assembled on 2002-05-15
GenBank Submission: AY118643
> SD03837.complete CGGAGCCGTGTCCAAGGATTCTCGATTCTCTATTCTCGATTCCCCATCTC TCAGCTCAAGCTTAAGCTATCTCCAAGATGTCGTACAAGGTGGAACCATT GCCCGATTCCTACGCCGGCCTGGGCGAGGGTCCCCATTGGGATGTGGCCA GGCAAAGCCTGTACTACGTGGATTTGGAGGCGGGCAGCCTGCTCCGCTAC GACTATGCCCAGAACAAGGTCTACAAGACGAAGATCGAGGGCGAAACCTT GGCCGGATTCGTGCTGCCGGTGGAGGGACGTCCGCAGGAGTTCGCCGTCG GCTGCGGTCGACGCGTGGTGATCGTCAACTGGGATGGCGTCTCGCCCAGC GCCAAGGTGGTGCGCACACTGTTCGAGGTGCAGCCACTGATGGAGAAGAA TCGTTTGAACGACGCCAAGGTTGATCCCCGTGGTCGCTTCTTTGGCGGCA CCATGCGCTACATTGGCGATGAGTTCGAGTTCCGTCACGGCGAGCTGTAC CGCTGGGAGGCCGGTGGCCAGGTGTCGGTGATCAAGGGCGATGTGGGCAT CTCCAATGGACTGGCATGGGACGAGAAGGCCAAGAAGTTCTACTACATCG ATACCACCGACTACGAGGTGAAGTCGTATGACTATGATTTCGAGACCGGC GTGGCTAGCAATCCCAAGGTTATATTCAATCTGCGCAAGAACAGTCCCAA GGATCATCTGCTGCCCGATGGCCTGACCATCGATACCGAGGGCAACCTGT ATGTGGCCACCTTCAATGGCGCCACCATCTACAAGGTTAATCCCAACACT GGCAAGATTCTGCTTGAGATCAAGTTCCCAACCAAACAGATTACCTCCGC CGCCTTCGGTGGCCCCAACTTGGACATCCTGTACGTGACCACTGCCGCCA AGTTCGATCAGCCCGCTCCAGCTGGCACCACCTACAAGGTGACCGGACTG AACGCCACCGGCTATCCCGGCGTCAACCTGAAGGTCTAGGAGCTGCAATC TCTATCTATCCTTAGCCGCAGTAAAATGTACCAATCGAATCCAAGTGCAA TTATATGTTATGCTCTTTAACGTTTTAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
regucalcin-RC | 1459 | regucalcin-RC | 74..1152 | 1..1079 | 5305 | 99.4 | Plus |
regucalcin.a | 1426 | regucalcin.a | 114..1119 | 74..1079 | 4940 | 99.4 | Plus |
regucalcin-RD | 1282 | regucalcin-RD | 87..1089 | 77..1079 | 4925 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 11907066..11907786 | 76..796 | 3605 | 100 | Plus |
chrX | 22417052 | chrX | 11907844..11908123 | 797..1076 | 1400 | 100 | Plus |
chr3R | 27901430 | chr3R | 10571165..10571882 | 793..76 | 455 | 70.9 | Minus |
chrX | 22417052 | chrX | 11905518..11905594 | 1..77 | 385 | 100 | Plus |
chr3R | 27901430 | chr3R | 10570911..10571103 | 989..797 | 260 | 75.6 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 12016001..12016721 | 76..796 | 3515 | 99.2 | Plus |
X | 23542271 | X | 12016779..12017061 | 797..1079 | 1415 | 100 | Plus |
3R | 32079331 | 3R | 14746410..14747127 | 793..76 | 455 | 70.9 | Minus |
X | 23542271 | X | 12014445..12014521 | 1..77 | 385 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 12024099..12024819 | 76..796 | 3515 | 99.1 | Plus |
X | 23527363 | X | 12024877..12025159 | 797..1079 | 1415 | 100 | Plus |
X | 23527363 | X | 12022543..12022619 | 1..77 | 385 | 100 | Plus |
3R | 31820162 | 3R | 14487862..14487958 | 172..76 | 245 | 83.5 | Minus |
3R | 31820162 | 3R | 14487415..14487491 | 619..543 | 220 | 85.7 | Minus |
3R | 31820162 | 3R | 14487241..14487317 | 793..717 | 175 | 81.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 11905518..11905594 | 1..77 | 100 | -> | Plus |
chrX | 11907068..11907786 | 78..796 | 100 | -> | Plus |
chrX | 11907844..11908123 | 797..1076 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RD | 48..960 | 77..989 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RD | 48..960 | 77..989 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RD | 48..960 | 77..989 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RD | 48..960 | 77..989 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RD | 48..960 | 77..989 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RC | 27..1102 | 1..1076 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RC | 27..1102 | 1..1076 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RC | 22..1097 | 1..1076 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RC | 27..1102 | 1..1076 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
regucalcin-RC | 22..1097 | 1..1076 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12016779..12017058 | 797..1076 | 100 | Plus | |
X | 12014445..12014521 | 1..77 | 100 | -> | Plus |
X | 12016003..12016721 | 78..796 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12016779..12017058 | 797..1076 | 100 | Plus | |
X | 12014445..12014521 | 1..77 | 100 | -> | Plus |
X | 12016003..12016721 | 78..796 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12016779..12017058 | 797..1076 | 100 | Plus | |
X | 12014445..12014521 | 1..77 | 100 | -> | Plus |
X | 12016003..12016721 | 78..796 | 99 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 11908478..11908554 | 1..77 | 100 | -> | Plus |
arm_X | 11910036..11910754 | 78..796 | 99 | -> | Plus |
arm_X | 11910812..11911091 | 797..1076 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 12024101..12024819 | 78..796 | 99 | -> | Plus |
X | 12024877..12025156 | 797..1076 | 100 | Plus | |
X | 12022543..12022619 | 1..77 | 100 | -> | Plus |
Translation from 77 to 988
> SD03837.hyp MSYKVEPLPDSYAGLGEGPHWDVARQSLYYVDLEAGSLLRYDYAQNKVYK TKIEGETLAGFVLPVEGRPQEFAVGCGRRVVIVNWDGVSPSAKVVRTLFE VQPLMEKNRLNDAKVDPRGRFFGGTMRYIGDEFEFRHGELYRWEAGGQVS VIKGDVGISNGLAWDEKAKKFYYIDTTDYEVKSYDYDFETGVASNPKVIF NLRKNSPKDHLLPDGLTIDTEGNLYVATFNGATIYKVNPNTGKILLEIKF PTKQITSAAFGGPNLDILYVTTAAKFDQPAPAGTTYKVTGLNATGYPGVN LKV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
regucalcin-PB | 303 | CG1803-PB | 1..303 | 1..303 | 1606 | 100 | Plus |
regucalcin-PC | 303 | CG1803-PC | 1..303 | 1..303 | 1606 | 100 | Plus |
regucalcin-PA | 303 | CG1803-PA | 1..303 | 1..303 | 1606 | 100 | Plus |
regucalcin-PD | 319 | CG1803-PD | 17..319 | 1..303 | 1606 | 100 | Plus |
smp-30-PD | 303 | CG7390-PD | 1..303 | 1..303 | 1173 | 71.9 | Plus |
Translation from 77 to 988
> SD03837.pep MSYKVEPLPDSYAGLGEGPHWDVARQSLYYVDLEAGSLLRYDYAQNKVYK TKIEGETLAGFVLPVEGRPQEFAVGCGRRVVIVNWDGVSPSAKVVRTLFE VQPLMEKNRLNDAKVDPRGRFFGGTMRYIGDEFEFRHGELYRWEAGGQVS VIKGDVGISNGLAWDEKAKKFYYIDTTDYEVKSYDYDFETGVASNPKVIF NLRKNSPKDHLLPDGLTIDTEGNLYVATFNGATIYKVNPNTGKILLEIKF PTKQITSAAFGGPNLDILYVTTAAKFDQPAPAGTTYKVTGLNATGYPGVN LKV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19376-PA | 303 | GF19376-PA | 1..303 | 1..303 | 1514 | 92.7 | Plus |
Dana\GF18130-PA | 577 | GF18130-PA | 274..577 | 1..303 | 1119 | 69.1 | Plus |
Dana\GF18129-PA | 305 | GF18129-PA | 2..305 | 1..303 | 1106 | 69.1 | Plus |
Dana\GF18130-PA | 577 | GF18130-PA | 1..275 | 1..289 | 843 | 56.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17702-PA | 318 | GG17702-PA | 16..318 | 1..303 | 1590 | 99 | Plus |
Dere\GG21077-PA | 303 | GG21077-PA | 1..303 | 1..303 | 1169 | 72.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24165-PA | 421 | GH24165-PA | 119..421 | 1..303 | 1425 | 86.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
regucalcin-PD | 319 | CG1803-PD | 17..319 | 1..303 | 1606 | 100 | Plus |
regucalcin-PB | 303 | CG1803-PB | 1..303 | 1..303 | 1606 | 100 | Plus |
regucalcin-PC | 303 | CG1803-PC | 1..303 | 1..303 | 1606 | 100 | Plus |
regucalcin-PA | 303 | CG1803-PA | 1..303 | 1..303 | 1606 | 100 | Plus |
smp-30-PD | 303 | CG7390-PD | 1..303 | 1..303 | 1173 | 71.9 | Plus |
smp-30-PB | 303 | CG7390-PB | 1..303 | 1..303 | 1173 | 71.9 | Plus |
smp-30-PA | 303 | CG7390-PA | 1..303 | 1..303 | 1173 | 71.9 | Plus |
smp-30-PC | 306 | CG7390-PC | 4..306 | 1..303 | 1173 | 71.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI21765-PA | 334 | GI21765-PA | 32..334 | 1..303 | 1410 | 86.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL20270-PA | 287 | GL20270-PA | 23..286 | 1..302 | 1183 | 77.2 | Plus |
Dper\GL23668-PA | 303 | GL23668-PA | 1..303 | 1..303 | 1179 | 71.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14770-PA | 325 | GA14770-PA | 23..324 | 1..302 | 1503 | 92.1 | Plus |
Dpse\GA26692-PA | 303 | GA26692-PA | 1..303 | 1..303 | 1179 | 71.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13249-PA | 315 | GM13249-PA | 22..315 | 10..303 | 1527 | 97.3 | Plus |
Dsec\GM25827-PA | 303 | GM25827-PA | 1..303 | 1..303 | 1166 | 71.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD17058-PA | 348 | GD17058-PA | 46..348 | 1..303 | 1585 | 98.7 | Plus |
Dsim\GD20401-PA | 303 | GD20401-PA | 4..302 | 1..299 | 1150 | 71.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18538-PA | 303 | GJ18538-PA | 1..303 | 1..303 | 1443 | 88.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10081-PA | 303 | GK10081-PA | 1..303 | 1..303 | 1430 | 86.1 | Plus |
Dwil\GK11687-PA | 601 | GK11687-PA | 1..303 | 1..303 | 1250 | 76.6 | Plus |
Dwil\GK11687-PA | 601 | GK11687-PA | 299..601 | 1..303 | 1155 | 71 | Plus |