Clone SD03973 Report

Search the DGRC for SD03973

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:39
Well:73
Vector:pOT2
Associated Gene/TranscriptCG11807-RA
Protein status:SD03973.pep: gold
Preliminary Size:2008
Sequenced Size:1941

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11807 2001-01-01 Release 2 assignment
CG11807 2001-07-04 Blastp of sequenced clone
CG11807 2003-01-01 Sim4 clustering to Release 3
CG11807 2008-04-29 Release 5.5 accounting
CG11807 2008-08-15 Release 5.9 accounting
CG11807 2008-12-18 5.12 accounting

Clone Sequence Records

SD03973.complete Sequence

1941 bp (1941 high quality bases) assembled on 2001-07-04

GenBank Submission: AY052088

> SD03973.complete
CTGATTGGACTATGTTTATTAAATGATTACTTGCTGGATGCGGATCCAGA
TGTTCGACCAAATCTCAGGGAAGCGGAAAGGACTGCGATGGCTTGCTATT
ACCGCCAGCATGCGGACACCACGGTGACGGTTCCAAAGTTTAGCAACGAG
AGTTCCAGCGGCGGAGTGACCTACTACGATATCAAGGTGCGAGTGGGCAA
GGTGGAATGGCTGGTGGAGCGCCGTTATCGGGACTTTGCAAATCTTCACG
AGAAGCTGGTTGGCGAGATCTCCATCAGTAAGAAGTTGCTGCCGCCGAAG
AAGCTGGTTGGAAACAAGCAGCCCTCCTTTTTGGAGCAACGTCGTGAACA
GTTGGAAATTTATCTTCAGGAGCTTCTCATCTACTTCCGGACAGAACTGC
CGCGAGCTCTGGCCGAGTTTCTGGACTTTAACAAGTACGACATTATTTAT
CTGCTACAAGATCTTGCCAAGCTGTTCAATGAAAGCGGTGATGCTCTGCT
CAGCTCCAAGAAGGAATACAACCTTTCAGCCCTAGAGGTCTACGCTATCA
GTGAGCGGCTTAGTCTTCCCTGCCCACCGAGCCTGGATCGCGGTGGAAAG
TACGACTTCTCGCACGTGCTGGACTTTTGCACACAACTTGTCGCTTTGGT
GGTCACCCCGGTCAAGGACAATGCTAGCTATGCCCAGGATTACAATACGG
TTGATGTGCCAATCGATCGCAGCAATATTATTCCGAACAGACTAAGTTTT
AATCTAAATGCCTTTCGCAATCTCAAGACGCTCAAATTTTCGGCCTTGTC
TACCGAAAACATTGTGGACATCGAACTTCTGAAGCCGACTCTCCAGACAA
TCTGTGTTCATAACACAACCATACAGAACATAAATCAAGTCCTGCTCTGC
GACAATCTGCACAAGCACTGCGATGTGCCAAGCCTGCTGCCAGAGACTAT
CCTTGCATCCCCCTCCGGATCCGGTCCCTCCACTTCTAATGGTAGTGCCT
TGGTCAGTGCGGATGCGTGGCAAGAGATAACAGAACTCGACCTGACAGGC
AATTTGCTAACCCAAATCGATGGCAGTGTACGAACAGCTCCAAAACTCAG
ACGCCTAATCCTTGACCAGAATCGAATACGGACCGTCCAAAATCTGGCCG
AACTTCCTCAACTCCAGTTGCTTTCGCTTTCTGGGAATCTTATAGCAGAG
TGTGTGGACTGGCATTTAACGATGGGAAACCTAGTCACTCTGAAGTTAGC
TCAGAACAAAATCAAGACACTAAGTGGTCTCCGAAAACTACTTTCACTGG
TTAATCTGGACCTTAGTTCCAATCAGATCGAAGAGCTTGATGAAGTTAAT
CATGTCGCCAATCTTCCGCTTCTAGAGACCCTTCGACTTACTGGAAATCC
GCTGGCGGGCAGTGTGGACTATCGCTCTCGCGTCCTTGCTCGGTTTCACG
AACGTGCTGCTGAAATATCTTTGGACAACGAACCTGGTAATCAGCAGGAG
CTAGATACTGCTTTGGTATTGTCCGCCCTTCTGCAATCAAAGCAACGTCA
GCAACAAAAGTGATCCTTCTGTATCGATTCCATATATAGACAAATCTGCG
AACGAAATTTTAAATCTTATCTTCTTTTATAAGTATTGCCTATTGATATT
TCTTGCAACTAAACCCTATTAACAAATATTATTTTCCTAAGGTTGTGGAT
TTTAAACGGTTTAAAGATTTCTTTCAAGGATATTTCCCACGTTAGAAGTA
ATTTTAATTTATTCAAAGTGATTTGTAAATTTCCATGTTTGTAAAATTCC
CCGTATTCAGCCAAACTCTAAATGTATATGTTTTATCATTTCTGTCCCCC
TTGATGTGCAATAATTCAATGCTCACTTCCAAACAAATAAGTTAAGTAAA
TCAAATAAATTATATATCTCGACAAAAAAAAAAAAAAAAAA

SD03973.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:26:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11807-RA 2054 CG11807-RA 105..2034 1..1930 9440 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11090230..11091111 536..1417 4275 99 Plus
chr2R 21145070 chr2R 11091170..11091676 1417..1923 2490 99.4 Plus
chr2R 21145070 chr2R 11088739..11089041 1..303 1515 100 Plus
chr2R 21145070 chr2R 11089102..11089339 302..539 1160 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:47:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15203020..15203901 536..1417 4275 99 Plus
2R 25286936 2R 15203960..15204473 1417..1930 2525 99.4 Plus
2R 25286936 2R 15201529..15201831 1..303 1515 100 Plus
2R 25286936 2R 15201892..15202129 302..539 1160 99.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:48:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15204219..15205100 536..1417 4275 98.9 Plus
2R 25260384 2R 15205159..15205672 1417..1930 2525 99.4 Plus
2R 25260384 2R 15202728..15203030 1..303 1515 100 Plus
2R 25260384 2R 15203091..15203328 302..539 1160 99.1 Plus
Blast to na_te.dros performed on 2019-03-16 00:25:26 has no hits.

SD03973.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:26:14 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11088739..11089041 1..303 100 -> Plus
chr2R 11089104..11089337 304..537 99 -> Plus
chr2R 11090232..11091111 538..1417 98 -> Plus
chr2R 11091171..11091676 1418..1923 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:59:32 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 1..1476 88..1563 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:12:47 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 1..1476 88..1563 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:52:38 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 1..1476 88..1563 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:43:59 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 1..1476 88..1563 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:00:28 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 1..1476 88..1563 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:05:09 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 6..1928 1..1923 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:12:47 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 6..1928 1..1923 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:52:38 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 23..1945 1..1923 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:43:59 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 6..1928 1..1923 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:00:28 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG11807-RA 23..1945 1..1923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:14 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15201529..15201831 1..303 100 -> Plus
2R 15201894..15202127 304..537 99 -> Plus
2R 15203022..15203901 538..1417 98 -> Plus
2R 15203961..15204466 1418..1923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:14 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15201529..15201831 1..303 100 -> Plus
2R 15201894..15202127 304..537 99 -> Plus
2R 15203022..15203901 538..1417 98 -> Plus
2R 15203961..15204466 1418..1923 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:26:14 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15201529..15201831 1..303 100 -> Plus
2R 15201894..15202127 304..537 99 -> Plus
2R 15203022..15203901 538..1417 98 -> Plus
2R 15203961..15204466 1418..1923 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:52:38 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11089034..11089336 1..303 100 -> Plus
arm_2R 11089399..11089632 304..537 99 -> Plus
arm_2R 11090527..11091406 538..1417 98 -> Plus
arm_2R 11091466..11091971 1418..1923 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:21:39 Download gff for SD03973.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15203093..15203326 304..537 99 -> Plus
2R 15202728..15203030 1..303 100 -> Plus
2R 15204221..15205100 538..1417 98 -> Plus
2R 15205160..15205665 1418..1923 99   Plus

SD03973.hyp Sequence

Translation from 0 to 1562

> SD03973.hyp
LIGLCLLNDYLLDADPDVRPNLREAERTAMACYYRQHADTTVTVPKFSNE
SSSGGVTYYDIKVRVGKVEWLVERRYRDFANLHEKLVGEISISKKLLPPK
KLVGNKQPSFLEQRREQLEIYLQELLIYFRTELPRALAEFLDFNKYDIIY
LLQDLAKLFNESGDALLSSKKEYNLSALEVYAISERLSLPCPPSLDRGGK
YDFSHVLDFCTQLVALVVTPVKDNASYAQDYNTVDVPIDRSNIIPNRLSF
NLNAFRNLKTLKFSALSTENIVDIELLKPTLQTICVHNTTIQNINQVLLC
DNLHKHCDVPSLLPETILASPSGSGPSTSNGSALVSADAWQEITELDLTG
NLLTQIDGSVRTAPKLRRLILDQNRIRTVQNLAELPQLQLLSLSGNLIAE
CVDWHLTMGNLVTLKLAQNKIKTLSGLRKLLSLVNLDLSSNQIEELDEVN
HVANLPLLETLRLTGNPLAGSVDYRSRVLARFHERAAEISLDNEPGNQQE
LDTALVLSALLQSKQRQQQK*

SD03973.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG11807-PC 491 CG11807-PC 1..491 30..520 2483 100 Plus
CG11807-PB 491 CG11807-PB 1..491 30..520 2483 100 Plus
CG11807-PA 491 CG11807-PA 1..491 30..520 2483 100 Plus
CG9044-PB 1295 CG9044-PB 6..328 152..500 229 25.4 Plus
CG9044-PC 1318 CG9044-PC 6..328 152..500 229 25.4 Plus

SD03973.pep Sequence

Translation from 87 to 1562

> SD03973.pep
MACYYRQHADTTVTVPKFSNESSSGGVTYYDIKVRVGKVEWLVERRYRDF
ANLHEKLVGEISISKKLLPPKKLVGNKQPSFLEQRREQLEIYLQELLIYF
RTELPRALAEFLDFNKYDIIYLLQDLAKLFNESGDALLSSKKEYNLSALE
VYAISERLSLPCPPSLDRGGKYDFSHVLDFCTQLVALVVTPVKDNASYAQ
DYNTVDVPIDRSNIIPNRLSFNLNAFRNLKTLKFSALSTENIVDIELLKP
TLQTICVHNTTIQNINQVLLCDNLHKHCDVPSLLPETILASPSGSGPSTS
NGSALVSADAWQEITELDLTGNLLTQIDGSVRTAPKLRRLILDQNRIRTV
QNLAELPQLQLLSLSGNLIAECVDWHLTMGNLVTLKLAQNKIKTLSGLRK
LLSLVNLDLSSNQIEELDEVNHVANLPLLETLRLTGNPLAGSVDYRSRVL
ARFHERAAEISLDNEPGNQQELDTALVLSALLQSKQRQQQK*

SD03973.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:45:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12314-PA 713 GF12314-PA 378..713 150..491 1547 87.4 Plus
Dana\GF12314-PA 713 GF12314-PA 1..149 1..150 712 88.7 Plus
Dana\GF15590-PA 1279 GF15590-PA 6..322 123..471 200 26.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20501-PA 491 GG20501-PA 1..491 1..491 2548 98.6 Plus
Dere\GG25106-PA 1292 GG25106-PA 6..328 123..471 206 25.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21113-PA 636 GH21113-PA 291..636 136..491 1484 82.4 Plus
Dgri\GH21113-PA 636 GH21113-PA 1..150 1..151 680 83.4 Plus
Dgri\GH11013-PA 1305 GH11013-PA 6..332 123..471 183 24.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG11807-PC 491 CG11807-PC 1..491 1..491 2483 100 Plus
CG11807-PB 491 CG11807-PB 1..491 1..491 2483 100 Plus
CG11807-PA 491 CG11807-PA 1..491 1..491 2483 100 Plus
CG9044-PB 1295 CG9044-PB 6..328 123..471 229 25.4 Plus
CG9044-PC 1318 CG9044-PC 6..328 123..471 229 25.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:45:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18719-PA 481 GI18719-PA 1..481 1..491 2157 83.9 Plus
Dmoj\GI17533-PA 1340 GI17533-PA 6..332 123..471 190 24.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10613-PA 672 GL10613-PA 332..672 145..491 1549 85.9 Plus
Dper\GL10613-PA 672 GL10613-PA 1..151 1..151 724 88.1 Plus
Dper\GL19045-PA 1234 GL19045-PA 6..328 123..471 193 24.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:45:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11211-PA 672 GA11211-PA 332..672 145..491 1543 85.6 Plus
Dpse\GA11211-PA 672 GA11211-PA 1..151 1..151 724 88.1 Plus
Dpse\GA21499-PA 1299 GA21499-PA 6..341 123..471 179 24 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:45:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21593-PA 491 GM21593-PA 1..491 1..491 2548 98.8 Plus
Dsec\GM18583-PA 1303 GM18583-PA 6..328 123..471 192 25.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11101-PA 491 GD11101-PA 1..491 1..491 2562 99.2 Plus
Dsim\GD23371-PA 1295 GD23371-PA 6..328 123..471 197 25.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:45:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21737-PA 480 GJ21737-PA 1..480 1..491 2162 84.1 Plus
Dvir\GJ15424-PA 1311 GJ15424-PA 6..332 123..471 204 25.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:45:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19704-PA 486 GK19704-PA 1..486 1..491 2085 81 Plus
Dwil\GK14707-PA 1325 GK14707-PA 6..324 123..471 214 24.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13634-PA 491 GE13634-PA 1..491 1..491 2531 97.8 Plus
Dyak\GE10981-PA 367 GE10981-PA 1..337 1..337 1606 92.6 Plus
Dyak\GE25745-PA 1300 GE25745-PA 6..328 123..471 201 25.1 Plus