Clone SD04329 Report

Search the DGRC for SD04329

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:43
Well:29
Vector:pOT2
Associated Gene/Transcripttra2-RA
Protein status:SD04329.pep: gold
Preliminary Size:1437
Sequenced Size:1373

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10128 2001-01-01 Release 2 assignment
CG10128 2001-09-19 Blastp of sequenced clone
CG10128 2003-01-01 Sim4 clustering to Release 3
tra2 2008-04-29 Release 5.5 accounting
tra2 2008-08-15 Release 5.9 accounting
tra2 2008-12-18 5.12 accounting

Clone Sequence Records

SD04329.complete Sequence

1373 bp (1373 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058768

> SD04329.complete
TATCGCCACCCCTGTCGAAGCGTGCGTCTTTCTAAACGCAGACAGAATAA
ATAAAACCTGACAAAGGCTATCAATTAATTGGTAAACACTGATTGGGTGT
GCAATATAGCAGGGAATCAAACCCTCAAAAATGTTTCGATAGGTAAGCAA
AAAGCCAATGGATCGGGAGCCACTCAGTAGCGGGCGTCTCCATTGCAGCG
CCAGATATAAACACAAGCGATCGGCGTCATCATCGTCAGCGGGGACAACT
TCATCCGGACACAAGGACCGCAGGTCTGACTACGATTACTGTGGCAGTCG
CCGGCACCAGCGGTCCTCCTCTCGCCGACGCTCCCGTTCGCGTTCCTCCT
CGGAGTCGCCGCCACCGGAGCCGCGTCATCGCTCCGGACGTTCATCACGC
GATCGGGAACGAATGCACAAGTCTCGCGAACATCCACAAGCAAGCCGCTG
CATAGGAGTCTTCGGACTGAACACAAATACCTCGCAGCACAAGGTACGCG
AGCTGTTCAACAAGTACGGACCCATCGAACGCATCCAGATGGTGATTGAC
GCACAAACACAGCGTTCCCGGGGCTTTTGTTTCATTTATTTTGAGAAACT
CAGCGATGCCCGCGCGGCTAAGGACAGCTGCTCCGGAATAGAAGTGGATG
GTCGCCGTATTCGCGTCGATTTCTCTATAACCCAACGGGCTCATACCCCA
ACTCCGGGTGTGTATTTGGGTCGTCAGCCGCGTGGAAAAGCTCCACGCTC
ATTTTCACCGCGTAGAGGACGCCGTGTGTATCACGATCGCTCCGCTTCGC
CCTATGACAACTATCGTGATCGCTATGATTACCGCAACGATCGCTACGAC
CGTAATCTCCGCAGGAGCCCTAGTCGCAACCGCTACACTCGCAACAGGAG
CTACAGCCGTTCACGCTCTCCGCAACTACGTCGAACTTCATCGCGCTATT
AAAGCGCCTGGGGAGGAGGCTACTTCATTAACTCGTGCTCCTAAGTTCGC
CCAACTGGATTGCGTCAAACGGGCTGTAAAGGAGCATACGACTGAAATAT
TGTGTTTTGGTGAATCCTATCCCATCTAATGCATTTGGTTGGCGAACAGC
TCGCAACTAGATTAATTAATTATTCACCCAAAACACCCTTAATCATAATA
ATTCGGTTACTATTATTAATGCTGTATAAAAACATAAATTGTAAATATCA
AATCAATTACCAACATTACATACAGAGGTCCGCATGGATTGTGATATGTA
TTTTAAAGGAACTGCAGCAAACTGATAATGATAACAACATTAAACTAATT
TTAATTATAAATGCAATTGTGCAGCAGGTACAAAATAAAGATTAATTTGT
ACAGAAAAAAAAAAAAAAAAAAA

SD04329.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:16:09
Subject Length Description Subject Range Query Range Score Percent Strand
tra2.c 1823 tra2.c 727..1807 272..1356 5160 98.8 Plus
tra2.a 1433 tra2.a 618..1417 553..1356 3785 98.6 Plus
tra2-RB 1428 tra2-RB 613..1412 553..1356 3785 98.6 Plus
tra2-RB 1428 tra2-RB 32..588 1..557 2710 99.1 Plus
tra2.a 1433 tra2.a 169..593 133..557 2080 99.2 Plus
tra2.c 1823 tra2.c 32..304 1..273 1335 99.2 Plus
tra2.a 1433 tra2.a 32..164 1..133 635 98.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:58:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10489325..10489745 1354..930 1905 98.1 Minus
chr2R 21145070 chr2R 10489805..10490183 931..553 1850 99.2 Minus
chr2R 21145070 chr2R 10490650..10490806 428..272 770 99.4 Minus
chr2R 21145070 chr2R 10491285..10491427 275..133 715 100 Minus
chr2R 21145070 chr2R 10491500..10491632 133..1 635 98.5 Minus
chr2R 21145070 chr2R 10490464..10490592 556..428 615 98.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:48:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:58:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14602020..14602442 1356..930 1915 98.1 Minus
2R 25286936 2R 14602502..14602880 931..553 1850 99.2 Minus
2R 25286936 2R 14603347..14603503 428..272 770 99.4 Minus
2R 25286936 2R 14603982..14604124 275..133 715 100 Minus
2R 25286936 2R 14604197..14604329 133..1 635 98.5 Minus
2R 25286936 2R 14603161..14603289 556..428 615 98.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14603219..14603641 1356..930 1945 98.1 Minus
2R 25260384 2R 14603701..14604079 931..553 1850 99.2 Minus
2R 25260384 2R 14604546..14604702 428..272 770 99.3 Minus
2R 25260384 2R 14605181..14605323 275..133 715 100 Minus
2R 25260384 2R 14605396..14605528 133..1 635 98.4 Minus
2R 25260384 2R 14604360..14604488 556..428 615 98.4 Minus
Blast to na_te.dros performed on 2019-03-16 15:58:24 has no hits.

SD04329.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:59:26 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10489325..10489745 930..1354 98 <- Minus
chr2R 10489807..10490179 557..929 99 <- Minus
chr2R 10490464..10490592 428..556 98 <- Minus
chr2R 10490651..10490804 274..427 99 <- Minus
chr2R 10491287..10491426 134..273 100 <- Minus
chr2R 10491500..10491632 1..133 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:00:00 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RF 1..795 158..952 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:57:53 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RF 1..795 158..952 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:22:59 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RG 1..795 158..952 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:27:08 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RF 1..795 158..952 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:51:35 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RG 1..795 158..952 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:44:27 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RF 24..1378 1..1354 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:57:53 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RF 24..1378 1..1354 98   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:22:59 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RA 9..1358 1..1354 98   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:27:08 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RF 24..1378 1..1354 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:51:35 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
tra2-RA 9..1358 1..1354 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:26 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14604197..14604329 1..133 98   Minus
2R 14602022..14602442 930..1354 98 <- Minus
2R 14602504..14602876 557..929 99 <- Minus
2R 14603161..14603289 428..556 98 <- Minus
2R 14603348..14603501 274..427 99 <- Minus
2R 14603984..14604123 134..273 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:26 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14604197..14604329 1..133 98   Minus
2R 14602022..14602442 930..1354 98 <- Minus
2R 14602504..14602876 557..929 99 <- Minus
2R 14603161..14603289 428..556 98 <- Minus
2R 14603348..14603501 274..427 99 <- Minus
2R 14603984..14604123 134..273 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:59:26 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14604197..14604329 1..133 98   Minus
2R 14602022..14602442 930..1354 98 <- Minus
2R 14602504..14602876 557..929 99 <- Minus
2R 14603161..14603289 428..556 98 <- Minus
2R 14603348..14603501 274..427 99 <- Minus
2R 14603984..14604123 134..273 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:22:59 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10489527..10489947 930..1354 98 <- Minus
arm_2R 10490009..10490381 557..929 99 <- Minus
arm_2R 10490666..10490794 428..556 98 <- Minus
arm_2R 10490853..10491006 274..427 99 <- Minus
arm_2R 10491489..10491628 134..273 100 <- Minus
arm_2R 10491702..10491834 1..133 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:04:24 Download gff for SD04329.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14604360..14604488 428..556 98 <- Minus
2R 14604547..14604700 274..427 99 <- Minus
2R 14605183..14605322 134..273 100 <- Minus
2R 14605396..14605528 1..133 98   Minus
2R 14603221..14603641 930..1354 98 <- Minus
2R 14603703..14604075 557..929 99 <- Minus

SD04329.pep Sequence

Translation from 157 to 951

> SD04329.pep
MDREPLSSGRLHCSARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRH
QRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIG
VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSD
ARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFS
PRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYS
RSRSPQLRRTSSRY*

SD04329.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13528-PA 261 GF13528-PA 11..245 14..243 611 68.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:30:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22415-PA 259 GG22415-PA 1..259 6..264 797 84.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21118-PA 366 GH21118-PA 134..305 22..188 492 63 Plus
Dgri\GH21118-PA 366 GH21118-PA 30..139 89..198 334 56.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
tra2-PF 264 CG10128-PF 1..264 1..264 1398 100 Plus
tra2-PA 264 CG10128-PA 1..264 1..264 1398 100 Plus
tra2-PG 264 CG10128-PG 1..264 1..264 1398 100 Plus
tra2-PD 226 CG10128-PD 2..226 40..264 1196 100 Plus
tra2-PC 226 CG10128-PC 2..226 40..264 1196 100 Plus
tra2-PE 179 CG10128-PE 1..179 86..264 953 100 Plus
tra2-PB 136 CG10128-PB 1..133 1..133 699 100 Plus
snRNP-U1-70K-PC 448 CG8749-PC 102..296 97..263 162 28.6 Plus
snRNP-U1-70K-PA 448 CG8749-PA 102..296 97..263 162 28.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18722-PA 248 GI18722-PA 32..175 46..189 541 70.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:30:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10640-PA 277 GL10640-PA 71..235 69..235 513 63.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10094-PA 248 GA10094-PA 42..206 69..235 514 63.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:30:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20203-PA 265 GM20203-PA 1..265 1..264 985 91.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:30:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25673-PA 180 GD25673-PA 1..180 86..264 804 93.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\tra2-PA 315 GJ21740-PA 92..247 36..192 564 72 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:30:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15735-PA 277 GK15735-PA 68..199 65..192 536 76.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:30:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12305-PA 181 GE12305-PA 2..181 85..264 710 82.8 Plus

SD04329.hyp Sequence

Translation from 157 to 951

> SD04329.hyp
MDREPLSSGRLHCSARYKHKRSASSSSAGTTSSGHKDRRSDYDYCGSRRH
QRSSSRRRSRSRSSSESPPPEPRHRSGRSSRDRERMHKSREHPQASRCIG
VFGLNTNTSQHKVRELFNKYGPIERIQMVIDAQTQRSRGFCFIYFEKLSD
ARAAKDSCSGIEVDGRRIRVDFSITQRAHTPTPGVYLGRQPRGKAPRSFS
PRRGRRVYHDRSASPYDNYRDRYDYRNDRYDRNLRRSPSRNRYTRNRSYS
RSRSPQLRRTSSRY*

SD04329.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
tra2-PF 264 CG10128-PF 1..264 1..264 1398 100 Plus
tra2-PA 264 CG10128-PA 1..264 1..264 1398 100 Plus
tra2-PG 264 CG10128-PG 1..264 1..264 1398 100 Plus
tra2-PD 226 CG10128-PD 2..226 40..264 1196 100 Plus
tra2-PC 226 CG10128-PC 2..226 40..264 1196 100 Plus