Clone SD05004 Report

Search the DGRC for SD05004

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:50
Well:4
Vector:pOT2
Associated Gene/Transcript128up-RA
Protein status:SD05004.pep: gold
Preliminary Size:1418
Sequenced Size:1321

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8340 2001-01-01 Release 2 assignment
CG8340 2003-01-01 Sim4 clustering to Release 3
CG8340 2003-01-14 Blastp of sequenced clone
128up 2008-04-29 Release 5.5 accounting
128up 2008-08-15 Release 5.9 accounting
128up 2008-12-18 5.12 accounting

Clone Sequence Records

SD05004.complete Sequence

1321 bp (1321 high quality bases) assembled on 2003-01-14

GenBank Submission: AY069810

> SD05004.complete
CCACGCGAGAGTTTTATATATTTTATTTTTACATGCATATTTGTTGATAA
CTGGGGTTTTCTGTGAACCGCGTTTAACTCTCAGCCAGCCATGAGCACAA
TATTGGAGAAAATCTCGGCCATCGAGTCGGAGATGGCCCGAACCCAAAAG
AACAAGGCCACCTCGGCCCATTTGGGTCTACTGAAGGCGAAGCTGGCTAA
GCTGCGACGCGAACTGATTTCCCCCAAAGGAGGCGGCGGCGGAACCGGCG
AAGCTGGCTTCGAGGTGGCCAAGACTGGAGATGCCCGGGTGGGATTCGTA
GGGTTTCCTTCTGTGGGTAAATCCACACTGCTCTCCAACTTGGCTGGCGT
TTACTCCGAGGTGGCGGCATACGAATTCACAACGTTGACCACTGTGCCGG
GATGCATTAAGTACAAGGGCGCTAAGATCCAGCTGCTGGACTTGCCCGGT
ATCATTGAGGGCGCTAAGGATGGCAAGGGTCGAGGTCGTCAGGTGATTGC
TGTCGCTCGCACCTGTAACCTCATTTTCATGGTGCTGGATTGCCTGAAAC
CGCTTGGCCACAAGAAACTCCTCGAGCATGAATTGGAGGGCTTCGGCATC
CGGCTTAACAAGAAACCACCAAATATCTACTACAAGCGGAAGGACAAGGG
TGGCATCAATCTGAACAGCATGGTTCCGCAGTCCGAGTTGGACACGGATC
TGGTGAAGACCATTCTATCCGAGTACAAGATCCACAATGCGGACATCACC
CTGAGATACGACGCCACTAGTGACGACCTCATTGACGTTATCGAGGGCAA
CCGCATCTACATACCCTGCATATATCTGCTGAACAAGATCGATCAGATCT
CCATCGAGGAGCTGGACGTCATCTACAAGATCCCGCATTGCGTGCCCATC
TCGGCCCATCACCACTGGAACTTTGACGATCTGCTGGAGCTGATGTGGGA
ATACCTGCGACTGCAGCGCATCTACACCAAGCCCAAGGGCCAGCTGCCCG
ATTACAACTCGCCCGTGGTACTCCACAACGAGCGCACCAGCATTGAGGAT
TTCTGCAACAAGCTGCATCGCTCCATTGCCAAGGAATTTAAATATGCGCT
GGTTTGGGGCTCATCTGTGAAGCATCAGCCACAGAAGGTGGGCATCGAAC
ACGTTCTCAACGACGAGGATGTGGTCCAGATTGTGAAGAAGGTTTAGACT
CTGTGCAACGATAACACTTTGATTACTTGATGGCATTTTTTATTCGAAAA
TAAAAAACGAATGTGCTTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAA

SD05004.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
128up-RA 1499 128up-RA 110..1379 1..1270 6350 100 Plus
CG6195-RA 1398 CG6195-RA 516..624 405..513 215 79.8 Plus
CG6195-RA 1398 CG6195-RA 943..978 832..867 165 97.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7924991..7925833 252..1094 4215 100 Plus
chr2R 21145070 chr2R 7925899..7926073 1095..1269 860 99.4 Plus
chr2R 21145070 chr2R 7924555..7924686 1..132 660 100 Plus
chr2R 21145070 chr2R 7924817..7924943 131..257 620 99.2 Plus
chr3R 27901430 chr3R 15471562..15471670 513..405 215 79.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:48:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12037769..12038611 252..1094 4215 100 Plus
2R 25286936 2R 12038677..12038852 1095..1270 880 100 Plus
2R 25286936 2R 12037333..12037464 1..132 660 100 Plus
2R 25286936 2R 12037595..12037717 131..253 615 100 Plus
3R 32079331 3R 19647729..19647837 513..405 215 79.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12038968..12039810 252..1094 4215 100 Plus
2R 25260384 2R 12039876..12040051 1095..1270 880 100 Plus
2R 25260384 2R 12038532..12038663 1..132 660 100 Plus
2R 25260384 2R 12038794..12038916 131..253 615 100 Plus
3R 31820162 3R 19388560..19388668 513..405 215 79.8 Minus
3R 31820162 3R 19388206..19388241 867..832 165 97.2 Minus
Blast to na_te.dros performed 2019-03-16 07:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
gtwin 7411 gtwin GTWIN 7411bp 3268..3358 909..820 128 61.5 Minus

SD05004.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:51:22 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7924555..7924686 1..132 100 -> Plus
chr2R 7924819..7924939 133..253 100 -> Plus
chr2R 7924993..7925833 254..1094 100 -> Plus
chr2R 7925899..7926073 1095..1269 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:00:44 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 1..1107 91..1197 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:56:44 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 1..1107 91..1197 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:48:43 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 1..1107 91..1197 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:36 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 1..1107 91..1197 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:41:25 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 1..1107 91..1197 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:35 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 28..1296 1..1269 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:56:43 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 28..1296 1..1269 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:48:43 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 36..1304 1..1269 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:36 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 28..1296 1..1269 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:41:25 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
128up-RA 36..1304 1..1269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:22 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12037333..12037464 1..132 100 -> Plus
2R 12037597..12037717 133..253 100 -> Plus
2R 12037771..12038611 254..1094 100 -> Plus
2R 12038677..12038851 1095..1269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:22 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12037333..12037464 1..132 100 -> Plus
2R 12037597..12037717 133..253 100 -> Plus
2R 12037771..12038611 254..1094 100 -> Plus
2R 12038677..12038851 1095..1269 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:51:22 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12037333..12037464 1..132 100 -> Plus
2R 12037597..12037717 133..253 100 -> Plus
2R 12037771..12038611 254..1094 100 -> Plus
2R 12038677..12038851 1095..1269 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:48:43 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7924838..7924969 1..132 100 -> Plus
arm_2R 7925102..7925222 133..253 100 -> Plus
arm_2R 7926182..7926356 1095..1269 100   Plus
arm_2R 7925276..7926116 254..1094 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:18:54 Download gff for SD05004.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12039876..12040050 1095..1269 100   Plus
2R 12038970..12039810 254..1094 100 -> Plus
2R 12038532..12038663 1..132 100 -> Plus
2R 12038796..12038916 133..253 100 -> Plus

SD05004.pep Sequence

Translation from 90 to 1196

> SD05004.pep
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV*

SD05004.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12286-PA 368 GF12286-PA 1..368 1..368 1934 99.2 Plus
Dana\GF17362-PA 363 GF17362-PA 3..363 4..367 1113 57.7 Plus
Dana\GF14685-PA 376 GF14685-PA 205..376 65..219 197 33.9 Plus
Dana\GF15477-PA 383 GF15477-PA 158..293 65..188 179 37.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:46:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20239-PA 368 GG20239-PA 1..368 1..368 1944 99.7 Plus
Dere\GG15886-PA 363 GG15886-PA 3..363 4..367 1102 56.9 Plus
Dere\GG23451-PA 381 GG23451-PA 206..320 65..176 200 40.9 Plus
Dere\GG21611-PA 383 GG21611-PA 158..293 65..188 170 37.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20854-PA 368 GH20854-PA 1..368 1..368 1916 98.1 Plus
Dgri\GH23383-PA 363 GH23383-PA 3..363 4..367 1090 56.6 Plus
Dgri\GH10882-PA 375 GH10882-PA 198..366 65..215 210 34.3 Plus
Dgri\GH13046-PA 383 GH13046-PA 158..243 65..148 166 45.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:37
Subject Length Description Subject Range Query Range Score Percent Strand
128up-PA 368 CG8340-PA 1..368 1..368 1910 100 Plus
CG6195-PA 363 CG6195-PA 3..363 4..367 1056 56.3 Plus
CG13390-PA 381 CG13390-PA 148..329 29..185 202 31.3 Plus
CG10628-PA 383 CG10628-PA 130..293 47..188 179 34.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20960-PA 368 GI20960-PA 1..368 1..368 1924 98.6 Plus
Dmoj\GI10336-PA 367 GI10336-PA 3..367 4..367 1097 56.4 Plus
Dmoj\GI12998-PA 372 GI12998-PA 198..321 65..185 214 40.8 Plus
Dmoj\GI18192-PA 384 GI18192-PA 159..294 65..188 172 36.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:46:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17092-PA 368 GL17092-PA 1..368 1..368 1927 98.9 Plus
Dper\GL11955-PA 343 GL11955-PA 3..343 4..367 1036 54.9 Plus
Dper\GL11553-PA 241 GL11553-PA 1..135 1..135 681 99.3 Plus
Dper\GL11553-PA 241 GL11553-PA 134..223 213..302 492 97.8 Plus
Dper\GL25811-PA 382 GL25811-PA 191..321 50..176 193 38.9 Plus
Dper\GL25622-PA 383 GL25622-PA 158..293 65..188 172 38.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21003-PA 368 GA21003-PA 1..368 1..368 1927 98.9 Plus
Dpse\GA19430-PA 363 GA19430-PA 3..363 4..367 1096 56.9 Plus
Dpse\GA24766-PA 150 GA24766-PA 1..143 1..143 705 97.2 Plus
Dpse\GA24767-PA 102 GA24767-PA 13..84 231..302 408 98.6 Plus
Dpse\GA12249-PA 382 GA12249-PA 191..321 50..176 193 38.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21327-PA 368 GM21327-PA 1..368 1..368 1941 99.5 Plus
Dsec\GM26898-PA 363 GM26898-PA 3..363 4..367 1095 56.4 Plus
Dsec\GM12999-PA 381 GM12999-PA 206..320 65..176 202 40.9 Plus
Dsec\GM16989-PA 383 GM16989-PA 158..293 65..188 178 37.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10834-PA 353 GD10834-PA 1..353 1..368 1677 90.8 Plus
Dsim\GD20106-PA 363 GD20106-PA 3..363 4..367 1095 56.4 Plus
Dsim\GD22413-PA 381 GD22413-PA 206..320 65..176 200 40.9 Plus
Dsim\GD21736-PA 383 GD21736-PA 158..293 65..188 177 37.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20681-PA 368 GJ20681-PA 1..368 1..368 1935 98.9 Plus
Dvir\GJ10190-PA 363 GJ10190-PA 3..363 4..367 1103 57.1 Plus
Dvir\GJ11528-PA 376 GJ11528-PA 198..321 65..185 198 37.6 Plus
Dvir\GJ14682-PA 383 GJ14682-PA 158..293 65..188 173 36.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21337-PA 368 GK21337-PA 1..368 1..368 1923 98.1 Plus
Dwil\GK22817-PA 363 GK22817-PA 3..363 4..367 1101 56.9 Plus
Dwil\GK24168-PA 380 GK24168-PA 189..378 50..221 198 32.1 Plus
Dwil\GK15220-PA 384 GK15220-PA 159..294 65..188 168 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12398-PA 368 GE12398-PA 1..368 1..368 1951 100 Plus
Dyak\GE25118-PA 363 GE25118-PA 3..363 4..367 1099 56.6 Plus
Dyak\GE11035-PA 384 GE11035-PA 206..320 65..176 203 40.9 Plus
Dyak\GE12631-PA 383 GE12631-PA 158..293 65..188 175 37.4 Plus

SD05004.hyp Sequence

Translation from 90 to 1196

> SD05004.hyp
MSTILEKISAIESEMARTQKNKATSAHLGLLKAKLAKLRRELISPKGGGG
GTGEAGFEVAKTGDARVGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLT
TVPGCIKYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLIFMVLD
CLKPLGHKKLLEHELEGFGIRLNKKPPNIYYKRKDKGGINLNSMVPQSEL
DTDLVKTILSEYKIHNADITLRYDATSDDLIDVIEGNRIYIPCIYLLNKI
DQISIEELDVIYKIPHCVPISAHHHWNFDDLLELMWEYLRLQRIYTKPKG
QLPDYNSPVVLHNERTSIEDFCNKLHRSIAKEFKYALVWGSSVKHQPQKV
GIEHVLNDEDVVQIVKKV*

SD05004.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
128up-PA 368 CG8340-PA 1..368 1..368 1910 100 Plus
CG6195-PA 363 CG6195-PA 3..363 4..367 1056 56.3 Plus
CG13390-PA 381 CG13390-PA 148..329 29..185 202 31.3 Plus
CG10628-PA 383 CG10628-PA 130..293 47..188 179 34.5 Plus