Clone SD05285 Report

Search the DGRC for SD05285

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:52
Well:85
Vector:pOT2
Associated Gene/TranscriptSyb-RA
Protein status:SD05285.pep: gold
Preliminary Size:1011
Sequenced Size:810

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12210 2001-01-01 Release 2 assignment
CG12210 2003-03-19 Blastp of sequenced clone
Syb 2008-04-29 Release 5.5 accounting
Syb 2008-08-15 Release 5.9 accounting
Syb 2008-12-18 5.12 accounting

Clone Sequence Records

SD05285.complete Sequence

810 bp (810 high quality bases) assembled on 2003-03-19

GenBank Submission: BT009942

> SD05285.complete
CGGTCACACTGATCACAAGCTGATATTTCTATAAAAAAAAATAGTGCTAT
TTAAAAAGCAGCCGCAGTTTTCCGTGGAAAACCCGAAATACACAGCAGTA
TTCTACAGGCACATTGTCAAGCAAATTCACAATGGAGAACAACGAAGCCC
CCTCCCCCTCGGGATCCAACAACAACGAGAACAACAATGCAGCCCAGAAG
AAGCTGCAGCAGACCCAAGCCAAGGTGGACGAGGTGGTCGGGATTATGCG
TGTGAACGTGGAGAAGGTCCTGGAGCGGGACCAGAAGCTATCGGAACTGG
GCGAGCGTGCGGATCAGCTGGAGCAGGGAGCATCCCAGTTCGAGCAGCAG
GCCGGCAAGCTGAAGCGCAAGCAATGGTGGGCCAACATGAAGATGATGAT
CATCCTGGGCGTGATAGCCGTTGTGCTGCTCATCATCGTTCTGGTGTCCG
TTTGGCCGTCTAGTAGTGACAGCGGCAGTGGTGGAGGAAACAAGGCCATC
ACCCAAGCACCGCCGCACTAAAGGCCTCCTAGGGAGTGAGGTAAACACAT
GGATACGAAATGGAAAAGGACCAAACAAACACAACTGGGACGGAAACCTT
TCTGGTCTTTTTGCGCAATGAGAGAAGGGGAGATGAAGAAAATCAAAAGG
ATAACTTACTAAAATTGCGTCTAGCATATATTTAACCAGAATGTAATTAT
TAAATCTTAATGTTAAACTTAACATTTTTACGTGTCGTAGCCGAGACCAG
AGGTCCCATTAATGTGTATTGCATATATACAATTATATATAGTAAAAAAA
AAAAAAAAAA

SD05285.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:04
Subject Length Description Subject Range Query Range Score Percent Strand
Syb-RA 948 Syb-RA 21..812 1..791 3890 99.6 Plus
Syb-RD 1123 Syb-RD 21..468 1..448 2225 99.7 Plus
Syb-RD 1123 Syb-RD 682..1030 444..791 1690 99.4 Plus
Syb-RB 1192 Syb-RB 751..1099 444..791 1690 99.4 Plus
Syb-RB 1192 Syb-RB 268..537 179..448 1335 99.6 Plus
Syb-RB 1192 Syb-RB 21..198 1..178 890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6137007..6137355 791..444 1680 99.4 Minus
chr2R 21145070 chr2R 6138406..6138671 444..179 1300 99.2 Minus
chr2R 21145070 chr2R 6139815..6139935 121..1 605 100 Minus
chr2R 21145070 chr2R 6139460..6139519 179..120 300 100 Minus
chr3L 24539361 chr3L 1634924..1635035 365..254 230 80.4 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:48:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10249480..10249828 791..444 1680 99.4 Minus
2R 25286936 2R 10250879..10251144 444..179 1315 99.6 Minus
2R 25286936 2R 10252282..10252402 121..1 605 100 Minus
2R 25286936 2R 10251927..10251986 179..120 300 100 Minus
3L 28110227 3L 1635328..1635439 365..254 245 81.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10250679..10251027 791..444 1690 99.4 Minus
2R 25260384 2R 10252078..10252343 444..179 1315 99.6 Minus
2R 25260384 2R 10253481..10253601 121..1 605 100 Minus
2R 25260384 2R 10253126..10253185 179..120 300 100 Minus
3L 28103327 3L 1635328..1635439 365..254 245 81.2 Minus
Blast to na_te.dros performed on 2019-03-16 05:26:58 has no hits.

SD05285.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:28:02 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6139461..6139517 122..178 100 <- Minus
chr2R 6139815..6139935 1..121 100   Minus
chr2R 6137004..6137354 445..793 99 <- Minus
chr2R 6138406..6138671 179..444 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:00:59 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 1..390 132..521 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:01 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 1..390 132..521 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:10:35 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 1..390 132..521 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:28 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 1..390 132..521 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:35 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 1..390 132..521 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:17 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 8..802 1..793 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:01 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 8..802 1..793 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:10:35 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 16..810 1..793 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:28 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 8..802 1..793 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:35 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
Syb-RA 16..810 1..793 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:28:02 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10249477..10249827 445..793 99 <- Minus
2R 10250879..10251144 179..444 99 <- Minus
2R 10251928..10251984 122..178 100 <- Minus
2R 10252282..10252402 1..121 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:28:02 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10249477..10249827 445..793 99 <- Minus
2R 10250879..10251144 179..444 99 <- Minus
2R 10251928..10251984 122..178 100 <- Minus
2R 10252282..10252402 1..121 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:28:02 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10249477..10249827 445..793 99 <- Minus
2R 10250879..10251144 179..444 99 <- Minus
2R 10251928..10251984 122..178 100 <- Minus
2R 10252282..10252402 1..121 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:10:35 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6136982..6137332 445..793 99 <- Minus
arm_2R 6138384..6138649 179..444 99 <- Minus
arm_2R 6139433..6139489 122..178 100 <- Minus
arm_2R 6139787..6139907 1..121 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:35 Download gff for SD05285.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10250676..10251026 445..793 99 <- Minus
2R 10252078..10252343 179..444 99 <- Minus
2R 10253127..10253183 122..178 100 <- Minus
2R 10253481..10253601 1..121 100   Minus

SD05285.pep Sequence

Translation from 131 to 520

> SD05285.pep
MENNEAPSPSGSNNNENNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERD
QKLSELGERADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLL
IIVLVSVWPSSSDSGSGGGNKAITQAPPH*

SD05285.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12131-PA 132 GF12131-PA 1..131 1..108 486 78.6 Plus
Dana\GF24019-PA 190 GF24019-PA 37..129 11..103 323 71 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25222-PA 153 GG25222-PA 1..153 1..129 616 83 Plus
Dere\GG14581-PA 217 GG14581-PA 37..129 11..103 325 71 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20114-PA 126 GH20114-PA 1..110 1..93 398 80.9 Plus
Dgri\GH15523-PA 190 GH15523-PA 37..129 11..103 327 71 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
Syb-PE 129 CG12210-PE 1..129 1..129 651 100 Plus
Syb-PA 129 CG12210-PA 1..129 1..129 651 100 Plus
Syb-PC 152 CG12210-PC 1..152 1..129 614 84.2 Plus
Syb-PD 109 CG12210-PD 1..108 1..108 526 98.1 Plus
Syb-PB 132 CG12210-PB 1..131 1..108 489 80.2 Plus
nSyb-PJ 206 CG17248-PJ 28..139 11..125 322 61.7 Plus
nSyb-PK 125 CG17248-PK 28..120 11..103 320 71 Plus
nSyb-PI 135 CG17248-PI 37..129 11..103 320 71 Plus
nSyb-PH 135 CG17248-PH 37..129 11..103 320 71 Plus
nSyb-PF 183 CG17248-PF 28..120 11..103 320 71 Plus
nSyb-PA 183 CG17248-PA 28..120 11..103 320 71 Plus
nSyb-PG 192 CG17248-PG 37..129 11..103 320 71 Plus
nSyb-PE 192 CG17248-PE 37..129 11..103 320 71 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20208-PA 152 GI20208-PA 1..151 1..127 443 72.2 Plus
Dmoj\GI16800-PA 192 GI16800-PA 37..129 11..103 322 71 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10482-PA 131 GL10482-PA 1..130 1..108 460 78.5 Plus
Dper\GL20732-PA 189 GL20732-PA 36..128 11..103 323 71 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11480-PA 131 GA11480-PA 1..130 1..108 460 78.5 Plus
Dpse\GA28300-PA 189 GA28300-PA 36..128 11..103 323 71 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20541-PA 152 GM20541-PA 1..152 1..129 619 84.2 Plus
Dsec\GM14195-PA 221 GM14195-PA 37..129 11..103 322 71 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25998-PA 152 GD25998-PA 1..152 1..129 614 83.6 Plus
Dsim\GD17610-PA 213 GD17610-PA 37..129 11..103 323 71 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20156-PA 152 GJ20156-PA 1..151 1..127 421 72.2 Plus
Dvir\GJ12544-PA 189 GJ12544-PA 37..129 11..103 323 71 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18016-PA 132 GK18016-PA 1..131 1..108 457 75.6 Plus
Dwil\GK23666-PA 190 GK23666-PA 37..129 11..103 326 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Syb-PA 153 GE21677-PA 1..153 1..129 618 83.7 Plus
Dyak\GE20941-PA 223 GE20941-PA 37..129 11..103 323 71 Plus

SD05285.hyp Sequence

Translation from 131 to 520

> SD05285.hyp
MENNEAPSPSGSNNNENNNAAQKKLQQTQAKVDEVVGIMRVNVEKVLERD
QKLSELGERADQLEQGASQFEQQAGKLKRKQWWANMKMMIILGVIAVVLL
IIVLVSVWPSSSDSGSGGGNKAITQAPPH*

SD05285.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
Syb-PE 129 CG12210-PE 1..129 1..129 651 100 Plus
Syb-PA 129 CG12210-PA 1..129 1..129 651 100 Plus
Syb-PC 152 CG12210-PC 1..152 1..129 614 84.2 Plus
Syb-PD 109 CG12210-PD 1..108 1..108 526 98.1 Plus
Syb-PB 132 CG12210-PB 1..131 1..108 489 80.2 Plus