Clone SD06593 Report

Search the DGRC for SD06593

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:65
Well:93
Vector:pOT2
Associated Gene/TranscriptTim8-RA
Protein status:SD06593.pep: gold
Preliminary Size:593
Sequenced Size:702

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1728 2002-01-01 Sim4 clustering to Release 2
CG1728 2002-06-04 Blastp of sequenced clone
CG1728 2003-01-01 Sim4 clustering to Release 3
Tim8 2008-04-29 Release 5.5 accounting
Tim8 2008-08-15 Release 5.9 accounting
Tim8 2008-12-18 5.12 accounting

Clone Sequence Records

SD06593.complete Sequence

702 bp (702 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118649

> SD06593.complete
AACCTCAAACCTTAGAATATATGAAATTCCGGACGAGCCCGGTCAATTTG
TAGATTGCTCACTGAAAATCACACGATGTCCGATTTTGAGAACCTTTCCG
GCAATGACAAGGAGCTGCAGGAGTTCCTCTTGATTGAGAAACAGAAGGCA
CAGGTCAACGCGCAGATACACGAGTTCAACGAGATCTGCTGGGAGAAGTG
CATCGGCAAGCCGAGTACCAAGCTGGACCACGCCACCGAGACGTGCCTGA
GCAACTGCGTCGACCGATTCATCGACACGTCGCTGCTTATCACCCAGCGG
TTCGCTCAGATGCTCCAAAAGCGAGGTGGCGGCGACCTGTAGATTTGTTC
GCTTAATCGACACCGACACCGGGATCTGGGTATCCGAGTCCGTGGACGCT
TCCGTCACTGTCCTACTGTTAAATCTATTTTTAAACAAAAAATTATCATG
TAAGCACATTTTTTTCCGCGCTGCGTTTTCGCCGCCGACATCCAAAGTAT
GTGGCCCGTAGTCTGCACCCAGCCCGAAATTGAAATCCGTGATTCGAGTT
CCGGAATTAATATTTAATTCGGTAGCGCAACTCAATTGTTTGGTCGGCCC
TACGTTAGCGTACCGAAAATAAATACATCTTTCGTTTCGTACGTTTAAAA
AAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

SD06593.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-RA 873 Tim8-RA 111..759 1..650 3210 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:00:15
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11259861..11260347 163..650 2390 99.8 Plus
chrX 22417052 chrX 11259621..11259785 1..165 825 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:49:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:00:13
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11368701..11369187 163..650 2390 99.8 Plus
X 23542271 X 11368461..11368625 1..165 825 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11376799..11377285 163..650 2400 99.7 Plus
X 23527363 X 11376559..11376723 1..165 825 100 Plus
Blast to na_te.dros performed 2019-03-16 16:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 3256..3287 180..211 106 81.2 Plus

SD06593.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:01:15 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11259621..11259785 1..165 100 -> Plus
chrX 11259864..11260347 166..650 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:02:13 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..267 76..342 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:00 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..267 76..342 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:24:12 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..267 76..342 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:22:14 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..267 76..342 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:52:34 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..267 76..342 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:02:16 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..645 1..646 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:00 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..645 1..646 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:24:12 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RB 17..665 1..650 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:22:14 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RA 1..645 1..646 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:52:34 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
Tim8-RB 17..665 1..650 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:15 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
X 11368461..11368625 1..165 100 -> Plus
X 11368704..11369187 166..650 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:15 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
X 11368461..11368625 1..165 100 -> Plus
X 11368704..11369187 166..650 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:15 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
X 11368461..11368625 1..165 100 -> Plus
X 11368704..11369187 166..650 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:24:12 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11262494..11262658 1..165 100 -> Plus
arm_X 11262737..11263220 166..650 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:58 Download gff for SD06593.complete
Subject Subject Range Query Range Percent Splice Strand
X 11376802..11377285 166..650 99   Plus
X 11376559..11376723 1..165 100 -> Plus

SD06593.pep Sequence

Translation from 75 to 341

> SD06593.pep
MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKL
DHATETCLSNCVDRFIDTSLLITQRFAQMLQKRGGGDL*

SD06593.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19075-PA 89 GF19075-PA 1..89 1..88 447 96.6 Plus
Dana\GF21863-PA 84 GF21863-PA 15..79 20..82 134 38.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:05:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18412-PA 87 GG18412-PA 1..87 1..88 435 94.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12183-PA 88 GH12183-PA 1..88 1..88 394 81.8 Plus
Dgri\GH10210-PA 82 GH10210-PA 13..77 20..82 129 40 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:03
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-PB 88 CG1728-PB 1..88 1..88 464 100 Plus
Tim8-PA 88 CG1728-PA 1..88 1..88 464 100 Plus
CG34132-PA 84 CG34132-PA 15..79 20..82 135 38.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15714-PA 88 GI15714-PA 1..88 1..88 435 92 Plus
Dmoj\GI14974-PA 84 GI14974-PA 15..79 20..82 129 38.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14853-PA 86 GL14853-PA 1..84 1..83 380 86.9 Plus
Dper\GL19513-PA 84 GL19513-PA 1..83 1..83 337 68.7 Plus
Dper\GL19514-PA 76 GL19514-PA 14..75 22..88 158 46.3 Plus
Dper\GL20826-PA 92 GL20826-PA 17..90 20..88 130 35.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:05:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14436-PA 86 GA14436-PA 1..84 1..83 384 88.1 Plus
Dpse\GA25988-PA 84 GA25988-PA 1..83 1..83 322 67.5 Plus
Dpse\GA25989-PA 76 GA25989-PA 14..75 22..88 160 46.3 Plus
Dpse\GA11098-PA 92 GA11098-PA 17..90 20..88 130 35.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11476-PA 88 GM11476-PA 1..88 1..88 463 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15242-PA 88 GJ15242-PA 1..88 1..88 438 93.2 Plus
Dvir\GJ17233-PA 83 GJ17233-PA 14..78 20..82 130 40 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25334-PA 88 GK25334-PA 1..88 1..88 401 85.2 Plus
Dwil\GK21816-PA 88 GK21816-PA 1..88 1..88 380 79.5 Plus
Dwil\GK25366-PA 85 GK25366-PA 4..85 7..88 321 68.3 Plus
Dwil\GK21494-PA 89 GK21494-PA 1..86 1..85 319 68.6 Plus
Dwil\GK11560-PA 120 GK11560-PA 15..79 20..82 138 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15929-PA 88 GE15929-PA 1..88 1..88 462 98.9 Plus

SD06593.hyp Sequence

Translation from 75 to 341

> SD06593.hyp
MSDFENLSGNDKELQEFLLIEKQKAQVNAQIHEFNEICWEKCIGKPSTKL
DHATETCLSNCVDRFIDTSLLITQRFAQMLQKRGGGDL*

SD06593.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
Tim8-PB 88 CG1728-PB 1..88 1..88 464 100 Plus
Tim8-PA 88 CG1728-PA 1..88 1..88 464 100 Plus
CG34132-PA 84 CG34132-PA 15..79 20..82 135 38.5 Plus