Clone SD07020 Report

Search the DGRC for SD07020

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:70
Well:20
Vector:pOT2
Associated Gene/Transcript4EHP-RA
Protein status:SD07020.pep: gold
Preliminary Size:1266
Sequenced Size:1146

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18615 2001-01-01 Release 2 assignment
CG10716 2001-01-01 Release 2 assignment
CG33100 2002-03-20 Blastp of sequenced clone
CG33100 2003-01-01 Sim4 clustering to Release 3
4EHP 2008-04-29 Release 5.5 accounting
4EHP 2008-08-15 Release 5.9 accounting
4EHP 2008-12-18 5.12 accounting

Clone Sequence Records

SD07020.complete Sequence

1146 bp (1146 high quality bases) assembled on 2002-03-20

GenBank Submission: AY094966

> SD07020.complete
CGGACGCATGTTGTGTTGTGTACAAAAAGAAACGTCAAACTAAAGTCGAG
CGAACCAAAACTAAACGGCCAAAAAATAAGCAAACCCACTGAAAACCGGA
AAGGATAAGGCACAGGAAATACGATTGTTTACCAGAGAGAGCGGCGGACC
CGTAGCGAACCGCTCCCCGAAAAAGCGGCTGCCCCAAAAAATCGCCCACA
AGAGAATCCACCAAAAACCCATTTGCCCACACACACACACACACAACACA
CACACGCGCAGCCAAGGAGCAAAAGAAGAATTGCGCCAGAAGAAGCAGCA
GCATAAAGAATCTAGTAGTGCAAACACCCGGATCCACAGGTACTCGTTCC
AGAGGTTGGAACAGCGCCACAGGAACAGCCAAGCAGTCAGCAGGAGAGCA
CCAGTATCAGCTACCAGTCAGCATCATAATTGCCAGGATGAGCATGGAGA
AAGTAGCCAACAAGCAGTACGAGACGAAAAACTGGCCAGATATTGTCGAC
AGCGACGACAGCGATGTGGATAATCAGATAGATGTGGACAACCTGCCACC
ACTGGAGGTGGGACCCGGCGAGAACCGGCTGCAGCACACATACTGCCTCT
GGTTCTCTCGCAAGGAGACGCAGCGGGCGGCCGCCGACTACAGCAAGTCG
CTGCACATGGTCGGCCGGTGCGCCAGCGTGCAGCAGTGGTGGTCGCTCTA
CTCGCACCTCATCCGGCCCACCGCCCTGAAGCCCTACCGGGAGCTCCTCC
TCTTCAAGCAGGGCATCATACCGATGTGGGAGGACCCGGCGAACAGCAAG
GGCGGCCAGTGGTTGATACGACTGCGCAAGAACAAGGTCGACCGGGCCTG
GGAGAACGTTTGTATGGCGATGCTCGGGGAGCAGTTCCTCGTCGGCGACG
AGATATGCGGAGTCGTGCTACAGACGAAATATCCGGAGGATAGCTTATCA
GTATGGCACCGGACTGCCACTGATATGACCAGTACAACACGTATCCGTGA
TACGTTACGCAGGATATTAAATATACCTCTAACAACGGCATTGGAGTATA
AGATACACTGTGATAGCCTTAAATATGTTTCAATTAATAAAGGCCCATTG
AAAAGCTGAAATTCAGTGAATAACTATAAAAAAAAAAAAAAAAAAA

SD07020.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-RA 1457 4EHP-RA 126..1273 1..1146 5565 99.1 Plus
4EHP.b 2094 4EHP.b 126..1273 1..1146 5565 99.1 Plus
4EHP.f 1998 4EHP.f 126..1273 1..1146 5565 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19931789..19932264 476..1 2380 100 Minus
chr3R 27901430 chr3R 19930144..19930604 936..476 2305 100 Minus
chr3R 27901430 chr3R 19887577..19887726 1084..935 750 100 Minus
chr3R 27901430 chr3R 19887187..19887229 1127..1085 215 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:50:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24108469..24108946 476..1 2295 99.2 Minus
3R 32079331 3R 24106824..24107284 936..476 2260 99.3 Minus
3R 32079331 3R 24064182..24064331 1084..935 750 100 Minus
3R 32079331 3R 24063770..24063831 1146..1085 265 95.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:49:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23849300..23849777 476..1 2305 99.1 Minus
3R 31820162 3R 23847655..23848115 936..476 2260 99.3 Minus
3R 31820162 3R 23805013..23805162 1084..935 750 100 Minus
3R 31820162 3R 23804601..23804662 1146..1085 265 95.1 Minus
Blast to na_te.dros performed on 2019-03-16 16:00:16 has no hits.

SD07020.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:01:16 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19887187..19887229 1085..1127 100 <- Minus
chr3R 19887577..19887725 936..1084 100 <- Minus
chr3R 19930145..19930604 476..935 100 <- Minus
chr3R 19931790..19932264 1..475 93   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:33:29 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 1..672 438..1109 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:25:16 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 1..672 438..1109 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:24:19 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 1..672 438..1109 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:00:48 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 1..672 438..1109 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:52:41 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 1..672 438..1109 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:33:28 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 4..1132 1..1127 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:25:16 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 4..1132 1..1127 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:24:19 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 15..1143 1..1127 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:00:48 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 4..1132 1..1127 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:52:41 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RA 15..1143 1..1127 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:16 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24064182..24064330 936..1084 100 <- Minus
3R 24063789..24063831 1085..1127 100 <- Minus
3R 24106825..24107284 476..935 99 <- Minus
3R 24108470..24108946 1..475 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:16 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24064182..24064330 936..1084 100 <- Minus
3R 24063789..24063831 1085..1127 100 <- Minus
3R 24106825..24107284 476..935 99 <- Minus
3R 24108470..24108946 1..475 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:01:16 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24064182..24064330 936..1084 100 <- Minus
3R 24063789..24063831 1085..1127 100 <- Minus
3R 24106825..24107284 476..935 99 <- Minus
3R 24108470..24108946 1..475 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:24:19 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19889511..19889553 1085..1127 100 <- Minus
arm_3R 19889904..19890052 936..1084 100 <- Minus
arm_3R 19932547..19933006 476..935 99 <- Minus
arm_3R 19934192..19934668 1..475 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:33:55 Download gff for SD07020.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23847656..23848115 476..935 99 <- Minus
3R 23849301..23849777 1..475 99   Minus
3R 23804620..23804662 1085..1127 100 <- Minus
3R 23805013..23805161 936..1084 100 <- Minus

SD07020.pep Sequence

Translation from 437 to 1108

> SD07020.pep
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPEDSLSVWHRTATDMTSTTRIRDTLRRILNIPLTT
ALEYKIHCDSLKYVSINKGPLKS*

SD07020.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23230-PA 172 GF23230-PA 1..166 1..166 837 91 Plus
Dana\GF19995-PA 57 GF19995-PA 1..57 167..223 284 96.5 Plus
Dana\GF23736-PA 261 GF23736-PA 53..248 12..211 272 30.5 Plus
Dana\GF10327-PA 271 GF10327-PA 80..264 34..219 258 31.9 Plus
Dana\GF10894-PA 230 GF10894-PA 55..217 48..211 256 32.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12377-PA 223 GG12377-PA 1..223 1..223 1084 93.3 Plus
Dere\GG14453-PA 231 GG14453-PA 56..224 48..219 270 33.1 Plus
Dere\GG14044-PA 250 GG14044-PA 74..237 48..211 255 29.9 Plus
Dere\GG14292-PA 244 GG14292-PA 69..236 48..220 248 29.5 Plus
Dere\GG15032-PA 229 GG15032-PA 54..216 48..211 245 31.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19097-PA 223 GH19097-PA 1..223 1..223 1043 89.7 Plus
Dgri\GH12729-PA 300 GH12729-PA 100..287 19..211 281 31.6 Plus
Dgri\GH16860-PA 275 GH16860-PA 99..262 48..211 270 32.3 Plus
Dgri\GH14978-PA 232 GH14978-PA 57..223 48..215 267 31.6 Plus
Dgri\GH15637-PA 233 GH15637-PA 58..220 48..211 249 31.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:04:01
Subject Length Description Subject Range Query Range Score Percent Strand
eIF4EHP-PA 223 CG33100-PA 1..223 1..223 1199 100 Plus
eIF4EHP-PD 242 CG33100-PD 1..216 1..216 1159 99.5 Plus
eIF4EHP-PB 248 CG33100-PB 1..172 1..172 914 97.7 Plus
eIF4EHP-PC 186 CG33100-PC 1..166 1..166 905 100 Plus
eIF4E7-PA 429 CG32859-PA 231..415 26..210 284 31.9 Plus
eIF4E5-PA 232 CG8277-PA 57..219 48..211 262 31.7 Plus
eIF4E1-PC 248 CG4035-PC 72..235 48..211 258 29.9 Plus
eIF4E1-PI 259 CG4035-PI 83..246 48..211 258 29.9 Plus
eIF4E1-PH 259 CG4035-PH 83..246 48..211 258 29.9 Plus
eIF4E1-PD 259 CG4035-PD 83..246 48..211 258 29.9 Plus
eIF4E1-PB 259 CG4035-PB 83..246 48..211 258 29.9 Plus
eIF4E1-PF 259 CG4035-PF 83..246 48..211 258 29.9 Plus
eIF4E1-PE 259 CG4035-PE 83..246 48..211 258 29.9 Plus
eIF4E1-PG 259 CG4035-PG 83..246 48..211 258 29.9 Plus
eIF4E1-PA 259 CG4035-PA 83..246 48..211 258 29.9 Plus
eIF4E4-PA 229 CG10124-PA 34..216 25..211 251 28.9 Plus
eIF4E3-PA 244 CG8023-PA 69..236 48..220 249 29 Plus
eIF4E6-PC 173 CG1442-PC 9..160 21..173 212 30.1 Plus
eIF4E6-PB 173 CG1442-PB 9..160 21..173 212 30.1 Plus
eIF4E6-PA 173 CG1442-PA 9..160 21..173 212 30.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23433-PA 171 GI23433-PA 1..164 3..166 762 89.6 Plus
Dmoj\GI23436-PA 61 GI23436-PA 4..61 166..223 280 93.1 Plus
Dmoj\GI12684-PA 246 GI12684-PA 66..233 43..211 271 32.6 Plus
Dmoj\GI13141-PA 238 GI13141-PA 63..231 48..219 263 32 Plus
Dmoj\GI14982-PA 311 GI14982-PA 135..298 48..211 254 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24147-PA 231 GL24147-PA 1..200 1..201 787 78.6 Plus
Dper\GL12850-PA 198 GL12850-PA 22..185 48..211 264 31.1 Plus
Dper\GL24149-PA 57 GL24149-PA 1..57 167..223 263 89.5 Plus
Dper\GL13241-PA 223 GL13241-PA 22..210 30..211 254 29.5 Plus
Dper\GL26506-PA 219 GL26506-PA 44..211 48..220 230 27.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26519-PB 216 GA26519-PB 1..215 1..215 1012 90.2 Plus
Dpse\GA28658-PA 263 GA28658-PA 87..250 48..211 265 31.1 Plus
Dpse\GA28380-PA 227 GA28380-PA 40..214 38..211 251 32.4 Plus
Dpse\GA28599-PA 223 GA28599-PA 48..210 48..211 249 31.7 Plus
Dpse\GA23005-PA 233 GA23005-PA 43..220 34..211 234 28.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23515-PA 223 GM23515-PA 1..223 1..223 1185 98.2 Plus
Dsec\GM25004-PA 233 GM25004-PA 58..220 48..211 258 31.7 Plus
Dsec\GM24878-PA 269 GM24878-PA 93..262 48..217 256 30.1 Plus
Dsec\GM13832-PA 229 GM13832-PA 54..216 48..211 255 31.1 Plus
Dsec\GM25034-PA 244 GM25034-PA 69..236 48..220 246 29.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18325-PA 223 GD18325-PA 1..223 1..223 1184 97.8 Plus
Dsim\GD14038-PA 233 GD14038-PA 58..220 48..211 260 31.7 Plus
Dsim\GD12928-PA 269 GD12928-PA 93..262 48..217 256 30.1 Plus
Dsim\GD13118-PA 229 GD13118-PA 54..216 48..211 255 31.1 Plus
Dsim\GD14067-PA 244 GD14067-PA 69..236 48..220 246 29.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14537-PA 221 GJ14537-PA 1..221 3..223 1042 91.4 Plus
Dvir\GJ13832-PA 272 GJ13832-PA 96..259 48..211 273 32.3 Plus
Dvir\GJ13889-PA 238 GJ13889-PA 63..231 48..219 268 32.6 Plus
Dvir\GJ12668-PA 230 GJ12668-PA 50..217 43..211 265 32 Plus
Dvir\GJ19475-PA 323 GJ19475-PA 147..310 48..211 254 30.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11937-PA 221 GK11937-PA 1..221 3..223 1042 91 Plus
Dwil\GK14373-PA 235 GK14373-PA 52..222 40..211 285 33.7 Plus
Dwil\GK12168-PA 260 GK12168-PA 84..247 48..211 284 33.5 Plus
Dwil\GK20927-PA 266 GK20927-PA 90..253 48..211 276 32.3 Plus
Dwil\GK17737-PA 217 GK17737-PA 42..210 48..219 262 33.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10831-PA 223 GE10831-PA 1..223 1..223 1080 92.8 Plus
Dyak\GE21642-PA 231 GE21642-PA 56..224 48..219 272 33.1 Plus
Dyak\GE21247-PA 269 GE21247-PA 93..256 48..211 254 29.9 Plus
Dyak\GE20721-PA 244 GE20721-PA 69..236 48..220 250 29 Plus
Dyak\GE20475-PA 229 GE20475-PA 54..216 48..211 243 31.1 Plus

SD07020.hyp Sequence

Translation from 437 to 1108

> SD07020.hyp
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPEDSLSVWHRTATDMTSTTRIRDTLRRILNIPLTT
ALEYKIHCDSLKYVSINKGPLKS*

SD07020.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-PA 223 CG33100-PA 1..223 1..223 1199 100 Plus
4EHP-PD 242 CG33100-PD 1..216 1..216 1159 99.5 Plus
4EHP-PB 248 CG33100-PB 1..172 1..172 914 97.7 Plus
4EHP-PC 186 CG33100-PC 1..166 1..166 905 100 Plus
eIF4E-7-PA 429 CG32859-PA 231..415 26..210 284 31.9 Plus