Clone SD07085 Report

Search the DGRC for SD07085

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:70
Well:85
Vector:pOT2
Associated Gene/TranscriptcathD-RA
Protein status:SD07085.pep: gold
Preliminary Size:1438
Sequenced Size:1381

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1548 2001-01-01 Release 2 assignment
CG1548 2001-07-04 Blastp of sequenced clone
CG1548 2003-01-01 Sim4 clustering to Release 3
cathD 2008-04-29 Release 5.5 accounting
cathD 2008-08-15 Release 5.9 accounting
cathD 2008-12-18 5.12 accounting

Clone Sequence Records

SD07085.complete Sequence

1381 bp (1381 high quality bases) assembled on 2001-07-04

GenBank Submission: AY052119

> SD07085.complete
CATTTTCGCTGTGCCGCAATATTTAATTAACTGCAGCGATCATTGCAGTT
TTAGCCACCAGAGAAGCGTAACATAGAAATCAAAATGCAGAAGGTTGCAC
TGCTTCTAGTCGCCTTCCTGGCTGCGGCCGTGGCCCACCCAAATTCGCAG
GAGAAGCCCGGATTGCTGCGCGTACCGCTCCACAAATTTCAGTCGGCCCG
CCGGCACTTTGCGGATGTGGGCACGGAGCTGCAGCAATTGCGCATTAGGT
ACGGCGGAGGTGATGTGCCGGAACCGCTGTCCAACTATATGGACGCGCAG
TACTATGGGCCCATTGCCATTGGCTCGCCACCGCAGAACTTCCGTGTGGT
TTTCGACACCGGCTCCTCGAACTTGTGGGTGCCGTCCAAGAAGTGCCACC
TGACCAACATCGCCTGTTTGATGCACAACAAGTACGATGCCTCCAAGTCG
AAGACCTACACCAAGAACGGCACTGAGTTCGCCATCCAGTATGGCTCGGG
CAGCTTGTCCGGATACCTGTCCACGGATACGGTGTCCATTGCCGGCCTGG
ACATCAAGGATCAGACATTCGCTGAGGCGCTCAGTGAGCCGGGCCTGGTC
TTCGTAGCTGCCAAGTTCGACGGCATCCTAGGCCTGGGCTACAACTCCAT
CTCGGTGGACAAGGTGAAGCCGCCATTTTACGCCATGTACGAACAGGGTT
TGATCTCCGCTCCGGTGTTCTCATTCTACCTGAATCGCGATCCCGCCTCG
CCCGAGGGCGGTGAGATCATCTTTGGCGGCTCCGATCCCAACCACTACAC
TGGTGAATTCACCTACTTGCCCGTTACCCGCAAGGCCTACTGGCAAATCA
AGATGGATGCCGCCTCCATTGGCGATTTGCAGCTGTGCAAGGGCGGTTGC
CAGGTGATCGCTGACACCGGTACCTCACTAATTGCTGCGCCCTTGGAAGA
GGCCACCTCTATTAACCAGAAGATTGGTGGAACTCCCATCATCGGTGGTC
AGTATGTGGTTTCTTGCGATCTCATTCCCCAATTGCCGGTAATCAAGTTT
GTGCTGGGCGGAAAGACCTTCGAGCTCGAGGGCAAGGACTATATTCTCCG
TGTGGCCCAGATGGGTAAGACCATCTGTCTGTCCGGCTTTATGGGCTTGG
ACATCCCCCCTCCAAACGGACCCTTGTGGATCCTCGGTGACGTTTTCATT
GGCAAATACTACACCGAGTTTGACATGGGCAACGATCGTGTGGGCTTCGC
CGATGCCAAATAATCGAACAAAGAAAAGTATACTTAAAATTTAAATTGTA
AACATTATCGATCGATCCCATTGCGGGTTTCTCCGAAGAATAATATATAT
GTAATAGCTATAAAAAAAAAAAAAAAAAAAA

SD07085.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:57
Subject Length Description Subject Range Query Range Score Percent Strand
cathD-RA 1570 cathD-RA 100..1448 1..1349 6745 100 Plus
CG6508-RA 1272 CG6508-RA 402..497 483..578 195 80.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:56:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3709870..3710871 1002..1 4995 99.9 Minus
chr2R 21145070 chr2R 3709460..3709808 1349..1001 1745 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:50:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7822549..7823550 1002..1 5010 100 Minus
2R 25286936 2R 7822139..7822487 1349..1001 1745 100 Minus
2L 23513712 2L 10819524..10819619 483..578 195 80.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7823748..7824749 1002..1 5010 100 Minus
2R 25260384 2R 7823338..7823686 1349..1001 1745 100 Minus
2L 23513712 2L 10819524..10819619 483..578 195 80.2 Plus
Blast to na_te.dros performed on 2019-03-16 23:56:37 has no hits.

SD07085.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:57:28 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3709870..3710871 1..1002 99   Minus
chr2R 3709463..3709806 1003..1346 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:02:45 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 1..1179 85..1263 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:12:05 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 1..1179 85..1263 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:26:35 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 1..1179 85..1263 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:43:13 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 1..1179 85..1263 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:04:49 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 1..1179 85..1263 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:04:07 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 19..1370 1..1355 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:12:05 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 19..1370 1..1355 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:26:35 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 20..1371 1..1355 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:43:13 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 19..1370 1..1355 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:04:49 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
cathD-RA 20..1371 1..1355 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:57:28 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7815711..7815727 1345..1361 94 -> Minus
2R 7822144..7822485 1003..1344 100 <- Minus
2R 7822549..7823550 1..1002 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:57:28 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7815711..7815727 1345..1361 94 -> Minus
2R 7822144..7822485 1003..1344 100 <- Minus
2R 7822549..7823550 1..1002 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:57:28 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7815711..7815727 1345..1361 94 -> Minus
2R 7822144..7822485 1003..1344 100 <- Minus
2R 7822549..7823550 1..1002 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:26:35 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3703216..3703232 1345..1361 94 -> Minus
arm_2R 3709649..3709990 1003..1344 100 <- Minus
arm_2R 3710054..3711055 1..1002 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:20:51 Download gff for SD07085.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7816910..7816926 1345..1361 94 -> Minus
2R 7823343..7823684 1003..1344 100 <- Minus
2R 7823748..7824749 1..1002 100   Minus

SD07085.pep Sequence

Translation from 84 to 1262

> SD07085.pep
MQKVALLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQ
QLRIRYGGGDVPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVP
SKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTV
SIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYA
MYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRK
AYWQIKMDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGT
PIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLS
GFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADAK*

SD07085.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11236-PA 388 GF11236-PA 1..388 1..392 1871 91.8 Plus
Dana\GF13504-PA 402 GF13504-PA 22..401 27..392 1138 54.7 Plus
Dana\GF14369-PA 371 GF14369-PA 5..368 9..389 889 47.8 Plus
Dana\GF19728-PA 390 GF19728-PA 1..386 1..389 834 44.6 Plus
Dana\GF19727-PA 449 GF19727-PA 14..381 21..392 817 46 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10707-PA 390 GG10707-PA 1..390 1..392 2032 98 Plus
Dere\GG20455-PA 404 GG20455-PA 5..403 4..392 1164 54.2 Plus
Dere\GG23678-PA 392 GG23678-PA 20..387 27..389 921 48.9 Plus
Dere\GG24067-PA 372 GG24067-PA 19..369 27..389 880 48.9 Plus
Dere\GG24793-PA 404 GG24793-PA 2..401 1..389 823 42.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21578-PA 388 GH21578-PA 19..388 25..392 1737 87.8 Plus
Dgri\GH19747-PA 390 GH19747-PA 14..388 21..391 1201 56.1 Plus
Dgri\GH24623-PA 374 GH24623-PA 1..371 1..389 910 49.1 Plus
Dgri\GH24344-PA 373 GH24344-PA 18..370 27..389 903 50.1 Plus
Dgri\GH11416-PA 400 GH11416-PA 19..397 27..389 873 45.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:53
Subject Length Description Subject Range Query Range Score Percent Strand
cathD-PC 392 CG1548-PC 1..392 1..392 2061 100 Plus
cathD-PB 392 CG1548-PB 1..392 1..392 2061 100 Plus
cathD-PA 392 CG1548-PA 1..392 1..392 2061 100 Plus
CG10104-PA 404 CG10104-PA 5..403 4..392 1163 55.4 Plus
CG17134-PA 391 CG17134-PA 4..386 7..389 884 47.3 Plus
Bace-PB 372 CG13095-PB 8..369 6..389 853 47.4 Plus
Bace-PA 372 CG13095-PA 8..369 6..389 853 47.4 Plus
CG33128-PA 405 CG33128-PA 83..402 63..389 837 50.2 Plus
CG6508-PA 423 CG6508-PA 1..388 1..392 806 44.5 Plus
CG5863-PA 395 CG5863-PA 25..394 27..391 785 43.5 Plus
Pgcl-PA 407 CG13374-PA 8..377 5..389 710 43.1 Plus
CG31926-PB 410 CG31926-PB 82..408 65..391 650 42 Plus
CG31926-PA 410 CG31926-PA 82..408 65..391 650 42 Plus
CG17283-PA 465 CG17283-PA 142..459 65..389 629 43 Plus
CG5860-PA 370 CG5860-PA 1..370 1..392 626 37.5 Plus
CG31928-PB 418 CG31928-PB 82..415 63..389 568 39.9 Plus
CG31928-PA 418 CG31928-PA 82..415 63..389 568 39.9 Plus
CG31661-PA 393 CG31661-PA 76..392 61..391 516 37.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19550-PA 387 GI19550-PA 19..387 24..392 1700 87.8 Plus
Dmoj\GI20282-PA 392 GI20282-PA 22..390 27..391 1162 56.8 Plus
Dmoj\GI11125-PA 371 GI11125-PA 1..368 1..389 953 50 Plus
Dmoj\GI11124-PA 373 GI11124-PA 1..370 1..389 928 49.7 Plus
Dmoj\GI14567-PA 402 GI14567-PA 78..399 61..389 872 51.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11239-PA 388 GL11239-PA 1..388 1..392 1847 91.1 Plus
Dper\GL10692-PA 399 GL10692-PA 3..398 6..392 1229 56 Plus
Dper\GL26637-PA 387 GL26637-PA 20..382 27..389 905 48.1 Plus
Dper\GL15694-PA 401 GL15694-PA 5..397 6..389 903 46.6 Plus
Dper\GL25647-PA 373 GL25647-PA 1..370 1..389 869 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13759-PA 388 GA13759-PA 1..388 1..392 1847 91.1 Plus
Dpse\GA10074-PA 399 GA10074-PA 4..398 6..392 1225 56.8 Plus
Dpse\GA14340-PA 387 GA14340-PA 20..382 27..389 911 48.4 Plus
Dpse\GA17303-PA 401 GA17303-PA 5..397 6..389 896 46.4 Plus
Dpse\GA25369-PA 373 GA25369-PA 1..370 1..389 869 46.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20753-PA 392 GM20753-PA 1..392 1..392 2062 98.7 Plus
Dsec\GM21542-PA 398 GM21542-PA 5..397 4..392 1118 53.1 Plus
Dsec\GM18746-PA 392 GM18746-PA 66..387 63..389 922 53.5 Plus
Dsec\GM12869-PA 372 GM12869-PA 19..369 27..389 873 48.7 Plus
Dsec\GM16820-PA 405 GM16820-PA 2..402 1..389 824 42.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10217-PA 324 GD10217-PA 1..324 69..392 1701 98.8 Plus
Dsim\GD11051-PA 399 GD11051-PA 5..398 4..392 1167 55.1 Plus
Dsim\GD23736-PA 564 GD23736-PA 208..559 26..389 868 49.2 Plus
Dsim\GD23099-PA 405 GD23099-PA 2..402 1..389 826 42.6 Plus
Dsim\GD23735-PA 404 GD23735-PA 4..369 27..392 809 45.7 Plus
Dsim\GD23736-PA 564 GD23736-PA 20..257 27..254 623 52.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:03:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21122-PA 391 GJ21122-PA 1..391 1..392 1745 86 Plus
Dvir\GJ22010-PA 394 GJ22010-PA 18..392 21..391 1196 56.6 Plus
Dvir\GJ15982-PA 374 GJ15982-PA 1..371 1..389 929 49.6 Plus
Dvir\GJ15983-PA 372 GJ15983-PA 1..369 1..389 922 48.9 Plus
Dvir\GJ17077-PA 404 GJ17077-PA 82..401 63..389 872 50.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21682-PA 389 GK21682-PA 1..389 1..392 1835 87 Plus
Dwil\GK21477-PA 402 GK21477-PA 30..401 27..392 1229 58.3 Plus
Dwil\GK24836-PA 372 GK24836-PA 1..369 1..389 895 47.1 Plus
Dwil\GK19045-PA 411 GK19045-PA 89..408 63..389 840 48.9 Plus
Dwil\GK11645-PA 388 GK11645-PA 19..387 27..391 839 45.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:03:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23596-PA 392 GE23596-PA 1..392 1..392 2039 98.2 Plus
Dyak\GE13586-PA 404 GE13586-PA 5..403 4..392 1179 55 Plus
Dyak\GE18491-PA 392 GE18491-PA 68..387 65..389 913 53.5 Plus
Dyak\GE10927-PA 372 GE10927-PA 19..369 27..389 876 48.1 Plus
Dyak\GE17593-PA 404 GE17593-PA 2..401 1..389 812 42.2 Plus

SD07085.hyp Sequence

Translation from 84 to 1262

> SD07085.hyp
MQKVALLLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQ
QLRIRYGGGDVPEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVP
SKKCHLTNIACLMHNKYDASKSKTYTKNGTEFAIQYGSGSLSGYLSTDTV
SIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISVDKVKPPFYA
MYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRK
AYWQIKMDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGT
PIIGGQYVVSCDLIPQLPVIKFVLGGKTFELEGKDYILRVAQMGKTICLS
GFMGLDIPPPNGPLWILGDVFIGKYYTEFDMGNDRVGFADAK*

SD07085.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:14:43
Subject Length Description Subject Range Query Range Score Percent Strand
cathD-PA 392 CG1548-PA 1..392 1..392 2061 100 Plus
CG10104-PA 404 CG10104-PA 5..403 4..392 1163 55.4 Plus
CG17134-PA 391 CG17134-PA 4..386 7..389 884 47.3 Plus
Bace-PB 372 CG13095-PB 8..369 6..389 853 47.4 Plus
Bace-PA 372 CG13095-PA 8..369 6..389 853 47.4 Plus