Clone SD07148 Report

Search the DGRC for SD07148

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:71
Well:48
Vector:pOT2
Associated Gene/TranscriptRpt1-RA
Protein status:SD07148.pep: gold
Preliminary Size:1689
Sequenced Size:1518

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1341 2001-01-01 Release 2 assignment
CG17985 2001-01-01 Release 2 assignment
CG1341 2001-10-10 Blastp of sequenced clone
CG1341 2003-01-01 Sim4 clustering to Release 3
Rpt1 2008-04-29 Release 5.5 accounting
Rpt1 2008-08-15 Release 5.9 accounting
Rpt1 2008-12-18 5.12 accounting

Clone Sequence Records

SD07148.complete Sequence

1518 bp (1518 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061606

> SD07148.complete
CCAAATTGTTCAGTCATTCTCGCCGTAAAACAAAAGGAAAACATCGCATA
AACTCATTTTTTGCCTTAAAAACCGTACAATTGCAATCGAATAAGATGCC
GGACTACCTGGGCGACGACCAGCGCAAGGTGAAGCACGATGAGAAGGAGG
ACAAGGAGATCAAGTCCCTCGACGAAGGCGACATTGAGCTTCTAAAGACT
TATGGGCAGAGCCAGTATCACAAATCCATCAAGAGCATCGAGGAGGACAT
TCAAAAGGCTGTGAAGCAGGTGAACGAGCTGACTGGAATCAAGGAAAGCG
ACACGGGTCTGGCGCCACCAGCGCTCTGGGATTTGGCCGCCGACAAGCAG
ATCCTGCAAAACGAGCAACCGCTGCAGGTTGCCCGATGCACCAAGATCAT
CAACGCGGATTCCGACGACCCCAAGTATATCATCAATGTTAAGCAGTTCG
CCAAGTTCGTGGTGGACCTAGCTGACTCGGTGGCCCCTACTGACATAGAA
GAGGGAATGCGTGTGGGTGTCGACCGCAACAAGTACCAGATCCACATTCC
GCTGCCTCCCAAGATTGATCCTACGGTTACCATGATGCAGGTTGAGGACA
AGCCGGACGTCACCTACAGCGATGTGGGCGGCTGCAAGGAACAAATCGAA
AAGCTGCGCGAGGTGGTGGAGACGCCACTGCTGCACCCGGAAAAGTTCGT
CAATCTGGGTATTGAGCCGCCCAAAGGTGTGCTACTGTTTGGCCCACCGG
GAACGGGAAAGACCCTGTGTGCCCGCGCCGTTGCCAACCGCACGGACGCT
TGCTTTATCCGCGTCATTGGCTCTGAGCTGGTGCAAAAGTACGTGGGTGA
GGGCGCTCGTATGGTGCGCGAGCTCTTCGAAATGGCGCGTTCCAAAAAGG
CTTGTCTCATCTTCTTCGACGAAATTGATGCTATCGGTGGTGCCCGATTC
GACGATGGGGCCGGCGGCGACAACGAGGTGCAGCGCACCATGTTGGAGCT
GATTAACCAACTGGATGGCTTCGATCCGCGCGGAAATATCAAGGTGCTGA
TGGCCACCAACCGACCCGACACGTTGGATCCGGCGCTCATGCGTCCCGGT
CGTCTGGACCGAAAGGTGGAGTTCGGCCTGCCTGACCAGGACGGTCGCTC
GCACATCTTTAAGATTCACGCCCGCTCCATGTCCGTGGAGCGAGATATTC
GCTTCGATCTGCTGGCGCGTCTATGTCCCAACTCGACTGGTGCTGAGATC
CGGTCAGTATGCACGGAAGCGGGCATGTTCGCCATTCGGGCGCGTCGCAA
GGTGGCCACAGAGAAGGATTTCCTCGAAGCCGTCAAGAAGGTTATCAAGA
GCTACGCCAAGTTCAGCGCCACTCCACGCTACATGACCTACAACTAAGTT
ACATTTATTGGCACTATTCTGTATCCTCTGCAAACTGTAACACTGCAGCT
GGCAATTTATTAAATAAAGCGAAATCTATACCTCCACCAACTGAAAAAAA
AAAAAAAAAAAAAAAAAA

SD07148.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt1-RA 1513 Rpt1-RA 17..1513 1..1497 7485 100 Plus
Pros26_4-RA 1654 Pros26_4-RA 1128..1271 981..1124 240 77.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:37:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3539747..3541239 1493..1 7465 100 Minus
chr3R 27901430 chr3R 19753657..19753800 1124..981 240 77.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:50:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7652436..7653932 1497..1 7485 100 Minus
3R 32079331 3R 23930210..23930353 1124..981 240 77.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7653635..7655131 1497..1 7485 100 Minus
3R 31820162 3R 23671041..23671184 1124..981 240 77.7 Minus
Blast to na_te.dros performed on 2019-03-15 14:37:33 has no hits.

SD07148.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:38:12 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3539747..3541239 1..1493 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:02:50 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 1..1302 96..1397 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:38:14 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 1..1302 96..1397 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:38:16 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 1..1302 96..1397 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:07:09 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 1..1302 96..1397 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:05:34 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 1..1302 96..1397 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:19:16 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 17..1509 1..1493 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:38:14 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 17..1509 1..1493 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:38:16 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 23..1515 1..1493 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:07:09 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 17..1509 1..1493 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:05:34 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
Rpt1-RA 23..1515 1..1493 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:38:12 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7652440..7653932 1..1493 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:38:12 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7652440..7653932 1..1493 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:38:12 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7652440..7653932 1..1493 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:38:16 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3539945..3541437 1..1493 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:43:14 Download gff for SD07148.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7653639..7655131 1..1493 100   Minus

SD07148.hyp Sequence

Translation from 2 to 1396

> SD07148.hyp
KLFSHSRRKTKGKHRINSFFALKTVQLQSNKMPDYLGDDQRKVKHDEKED
KEIKSLDEGDIELLKTYGQSQYHKSIKSIEEDIQKAVKQVNELTGIKESD
TGLAPPALWDLAADKQILQNEQPLQVARCTKIINADSDDPKYIINVKQFA
KFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEDK
PDVTYSDVGGCKEQIEKLREVVETPLLHPEKFVNLGIEPPKGVLLFGPPG
TGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARSKKA
CLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLM
ATNRPDTLDPALMRPGRLDRKVEFGLPDQDGRSHIFKIHARSMSVERDIR
FDLLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVKKVIKS
YAKFSATPRYMTYN*

SD07148.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:57:06
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt1-PA 433 CG1341-PA 1..433 32..464 2237 100 Plus
Rpt6-PA 405 CG1489-PA 10..391 69..449 899 49.5 Plus
Rpt4-PB 397 CG3455-PB 12..382 64..447 864 45 Plus
Rpt6R-PA 399 CG2241-PA 53..384 111..448 859 52.7 Plus
Rpt4R-PB 398 CG7257-PB 78..383 142..447 812 48.4 Plus

SD07148.pep Sequence

Translation from 95 to 1396

> SD07148.pep
MPDYLGDDQRKVKHDEKEDKEIKSLDEGDIELLKTYGQSQYHKSIKSIEE
DIQKAVKQVNELTGIKESDTGLAPPALWDLAADKQILQNEQPLQVARCTK
IINADSDDPKYIINVKQFAKFVVDLADSVAPTDIEEGMRVGVDRNKYQIH
IPLPPKIDPTVTMMQVEDKPDVTYSDVGGCKEQIEKLREVVETPLLHPEK
FVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYV
GEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTML
ELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDQDG
RSHIFKIHARSMSVERDIRFDLLARLCPNSTGAEIRSVCTEAGMFAIRAR
RKVATEKDFLEAVKKVIKSYAKFSATPRYMTYN*

SD07148.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21725-PA 405 GF21725-PA 58..391 80..418 926 53.7 Plus
Dana\GF23322-PA 402 GF23322-PA 78..387 107..417 889 55 Plus
Dana\GF21021-PA 397 GF21021-PA 18..382 39..416 881 46.2 Plus
Dana\GF24499-PA 398 GF24499-PA 78..383 111..416 838 49 Plus
Dana\GF17023-PA 446 GF17023-PA 112..441 92..427 827 46.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19719-PA 405 GG19719-PA 58..391 80..418 926 53.7 Plus
Dere\GG11925-PA 401 GG11925-PA 77..386 107..417 886 54.7 Plus
Dere\GG17681-PA 397 GG17681-PA 12..382 33..416 885 45.7 Plus
Dere\GG15543-PA 398 GG15543-PA 78..383 111..416 834 48.7 Plus
Dere\GG12390-PA 439 GG12390-PA 105..434 92..427 827 46.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11847-PA 405 GH11847-PA 58..391 80..418 925 53.7 Plus
Dgri\GH14117-PA 407 GH14117-PA 82..393 107..418 907 54.8 Plus
Dgri\GH17814-PA 397 GH17814-PA 76..382 110..416 882 52.1 Plus
Dgri\GH19692-PA 439 GH19692-PA 105..434 92..427 828 46.7 Plus
Dgri\GH18966-PA 398 GH18966-PA 78..383 111..416 826 48.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
Rpt1-PA 433 CG1341-PA 1..433 1..433 2237 100 Plus
Rpt6-PA 405 CG1489-PA 10..391 38..418 899 49.5 Plus
Rpt4-PB 397 CG3455-PB 12..382 33..416 864 45 Plus
Rpt6R-PA 399 CG2241-PA 53..384 80..417 859 52.7 Plus
Rpt2-PB 439 CG5289-PB 105..434 92..427 814 46.7 Plus
Rpt2-PA 439 CG5289-PA 105..434 92..427 814 46.7 Plus
Rpt4R-PB 398 CG7257-PB 78..383 111..416 812 48.4 Plus
Rpt4R-PA 398 CG7257-PA 78..383 111..416 812 48.4 Plus
Rpt5-PA 428 CG10370-PA 125..416 122..416 759 49.5 Plus
Rpt3-PB 413 CG16916-PB 13..403 15..418 741 40.1 Plus
Rpt3-PA 413 CG16916-PA 13..403 15..418 741 40.1 Plus
Rpt3R-PD 405 CG9475-PD 84..395 107..418 732 45.5 Plus
Rpt3R-PC 405 CG9475-PC 84..395 107..418 732 45.5 Plus
CG5776-PB 799 CG5776-PB 516..780 156..416 528 40.8 Plus
CG5776-PA 799 CG5776-PA 516..780 156..416 528 40.8 Plus
TER94-PD 759 CG2331-PD 142..409 158..429 511 39.2 Plus
TER94-PA 801 CG2331-PA 184..451 158..429 511 39.2 Plus
TER94-PE 825 CG2331-PE 209..476 158..429 511 39.2 Plus
TER94-PC 826 CG2331-PC 209..476 158..429 511 39.2 Plus
CG6512-PB 697 CG6512-PB 196..447 172..422 508 42.3 Plus
CG6512-PA 826 CG6512-PA 325..576 172..422 508 42.3 Plus
TER94-PD 759 CG2331-PD 384..655 122..398 503 34.7 Plus
TER94-PA 801 CG2331-PA 426..697 122..398 503 34.7 Plus
TER94-PE 825 CG2331-PE 451..722 122..398 503 34.7 Plus
TER94-PC 826 CG2331-PC 451..722 122..398 503 34.7 Plus
smid-PI 910 CG8571-PI 476..853 1..398 465 31.2 Plus
smid-PG 910 CG8571-PG 476..853 1..398 465 31.2 Plus
smid-PH 927 CG8571-PH 493..870 1..398 465 31.2 Plus
smid-PC 943 CG8571-PC 509..886 1..398 465 31.2 Plus
smid-PA 944 CG8571-PA 510..887 1..398 465 31.2 Plus
YME1L-PB 736 CG3499-PB 287..538 165..417 447 41.8 Plus
YME1L-PD 739 CG3499-PD 290..541 165..417 447 41.8 Plus
YME1L-PC 740 CG3499-PC 291..542 165..417 447 41.8 Plus
Spg7-PC 819 CG2658-PC 338..594 172..424 431 38.4 Plus
Spg7-PA 819 CG2658-PA 338..594 172..424 431 38.4 Plus
Pex1-PA 1006 CG6760-PA 713..940 168..398 397 37.7 Plus
Kat60-PA 572 CG10229-PA 284..556 166..422 369 35.8 Plus
Kat60-PB 605 CG10229-PB 317..589 166..422 369 35.8 Plus
CG12010-PB 717 CG12010-PB 452..696 177..418 366 34.1 Plus
smid-PI 910 CG8571-PI 212..441 170..400 361 34.2 Plus
smid-PG 910 CG8571-PG 212..441 170..400 361 34.2 Plus
smid-PH 927 CG8571-PH 229..458 170..400 361 34.2 Plus
smid-PC 943 CG8571-PC 245..474 170..400 361 34.2 Plus
smid-PA 944 CG8571-PA 246..475 170..400 361 34.2 Plus
Pex6-PC 897 CG11919-PC 611..841 170..398 357 36 Plus
Pex6-PD 899 CG11919-PD 613..843 170..398 357 36 Plus
comt-PB 745 CG1618-PB 220..474 177..414 338 35 Plus
comt-PA 745 CG1618-PA 220..474 177..414 338 35 Plus
Vps4-PB 442 CG6842-PB 123..360 166..409 334 38.2 Plus
Vps4-PA 442 CG6842-PA 123..360 166..409 334 38.2 Plus
spas-PF 489 CG5977-PF 205..470 166..421 334 33 Plus
spas-PE 551 CG5977-PE 267..532 166..421 334 33 Plus
spas-PD 696 CG5977-PD 412..677 166..421 334 33 Plus
spas-PC 696 CG5977-PC 412..677 166..421 334 33 Plus
kat-60L1-PF 605 CG1193-PF 304..548 147..398 333 34.2 Plus
kat-60L1-PA 605 CG1193-PA 304..548 147..398 333 34.2 Plus
kat-60L1-PH 609 CG1193-PH 308..552 147..398 333 34.2 Plus
kat-60L1-PD 609 CG1193-PD 308..552 147..398 333 34.2 Plus
kat-60L1-PC 669 CG1193-PC 368..612 147..398 333 34.2 Plus
kat-60L1-PB 669 CG1193-PB 368..612 147..398 333 34.2 Plus
CG5776-PB 799 CG5776-PB 269..492 172..388 159 23.4 Plus
CG5776-PA 799 CG5776-PA 269..492 172..388 159 23.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14329-PA 405 GI14329-PA 58..391 80..418 925 53.7 Plus
Dmoj\GI10644-PA 404 GI10644-PA 57..390 80..418 917 53.1 Plus
Dmoj\GI16424-PA 397 GI16424-PA 76..382 110..416 880 52.1 Plus
Dmoj\GI23296-PA 393 GI23296-PA 73..378 111..416 828 49 Plus
Dmoj\GI22277-PA 439 GI22277-PA 105..434 92..427 828 46.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20276-PA 397 GL20276-PA 76..382 110..416 882 52.1 Plus
Dper\GL25072-PA 389 GL25072-PA 69..374 111..416 850 50 Plus
Dper\GL16409-PA 269 GL16409-PA 1..255 164..418 825 60.4 Plus
Dper\GL24166-PA 417 GL24166-PA 145..412 158..427 808 53.3 Plus
Dper\GL23259-PA 428 GL23259-PA 131..416 126..416 782 49.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12266-PB 433 GA12266-PB 1..433 1..433 2280 99.1 Plus
Dpse\GA13327-PA 405 GA13327-PA 58..391 80..418 926 53.7 Plus
Dpse\GA17461-PA 397 GA17461-PA 76..382 110..416 882 52.1 Plus
Dpse\GA26607-PA 405 GA26607-PA 81..391 107..418 881 54.8 Plus
Dpse\GA20215-PA 389 GA20215-PA 69..374 111..416 850 50 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23074-PA 405 GM23074-PA 58..391 80..418 926 53.7 Plus
Dsec\GM12144-PA 400 GM12144-PA 76..385 107..417 883 54.7 Plus
Dsec\GM25309-PA 398 GM25309-PA 78..383 111..416 827 48.4 Plus
Dsec\GM23527-PA 439 GM23527-PA 105..434 92..427 827 46.7 Plus
Dsec\GM26527-PA 428 GM26527-PA 131..416 126..416 787 50.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17527-PA 405 GD17527-PA 58..391 80..418 926 53.7 Plus
Dsim\GD16958-PA 400 GD16958-PA 76..385 107..417 882 54.7 Plus
Dsim\GD14340-PA 398 GD14340-PA 78..383 111..416 827 48.4 Plus
Dsim\GD18337-PA 439 GD18337-PA 105..434 92..427 827 46.7 Plus
Dsim\GD21035-PA 428 GD21035-PA 131..416 126..416 783 49.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19383-PA 405 GJ19383-PA 58..391 80..418 925 53.7 Plus
Dvir\GJ23001-PA 408 GJ23001-PA 61..394 80..418 916 53.1 Plus
Dvir\GJ15827-PA 397 GJ15827-PA 76..382 110..416 878 51.8 Plus
Dvir\GJ24151-PA 399 GJ24151-PA 79..384 111..416 829 49 Plus
Dvir\GJ24070-PA 444 GJ24070-PA 110..439 92..427 828 46.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10072-PA 433 GK10072-PA 1..433 1..433 2282 99.1 Plus
Dwil\GK17804-PA 698 GK17804-PA 193..619 3..429 2243 98.8 Plus
Dwil\GK10708-PA 433 GK10708-PA 1..433 1..433 2240 97.2 Plus
Dwil\GK16292-PA 405 GK16292-PA 58..391 80..418 925 53.7 Plus
Dwil\GK25687-PA 397 GK25687-PA 76..382 110..416 878 52.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:39:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17917-PA 405 GE17917-PA 58..391 80..418 926 53.7 Plus
Dyak\GE16469-PA 397 GE16469-PA 12..382 33..416 885 45.7 Plus
Dyak\GE23375-PA 401 GE23375-PA 77..386 107..417 885 54.7 Plus
Dyak\GE21865-PA 398 GE21865-PA 78..383 111..416 831 48.7 Plus
Dyak\GE10845-PA 439 GE10845-PA 105..434 92..427 827 46.7 Plus