Clone SD07170 Report

Search the DGRC for SD07170

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:71
Well:70
Vector:pOT2
Associated Gene/TranscriptSp7-RD
Protein status:SD07170.pep: wuzgold
Preliminary Size:1936
Sequenced Size:1874

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3066 2001-01-01 Release 2 assignment
CG3066 2001-09-19 Blastp of sequenced clone
CG3066 2003-01-01 Sim4 clustering to Release 3
Sp7 2008-04-29 Release 5.5 accounting
Sp7 2008-08-15 Release 5.9 accounting
Sp7 2008-12-18 5.12 accounting

Clone Sequence Records

SD07170.complete Sequence

1874 bp (1874 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060475

> SD07170.complete
ATTAACAAAAACGTGATAAGCAATAAAAAAAATATATCAAACGAAGTTTT
TTCAGATTCCAGATTAATACACGCTTCCTTAACTTTGTAAAGGTTGTAAA
ATATGATCAAGTTTTGAGCGAGGCTGTTTTTGGGTCCAGCAAAAAATAAT
CTAAAAATGTTTTGATCTGTAAGAAGTACGTGCTTAGTGAGGTCTACCTG
TATATAGGATCTGTACACTCTAGGGAGAAAGCATCAAAATCCGAGTACCA
AAGCTTTTCAAAAGATCTCTTTCTTAGTTGTGATAAGCTCGGCTCAAGTC
TCTTGATGGGCTTGAAAGCTTTACTCACGGCCTCTCTGGGACAGTATCTC
TCAACGACGAATCGATTATCATCTGCGATCGCATTTAAAAAGTCTCTCGC
CCGTTAATTCGCGATCAGTTGTCTCTGCGTATCGAAGGCGTTCGTAGTTT
AATTTCGCTCTTCACGGTTCTCTGGTTCGAGGTCGACGCGCGTAATCGCA
AAGACGCGTTCTTATTAAATAAGCTGTGAAATTTCTTATTAAAATTGGTG
GGAAATATCCCAGAAGATGAAATCAACACGCAAAGTAGTTGGGATTTTTT
TGGCCACCTGCCTGCTGCCTTTCACCGTTCTACAAAATGTTGCGGCACAA
GGAAGTTGTAGGAATCCCAACCAGAAACAGGGACAATGTTTGTCCATATA
CGACTGTCAAAGTCTGCTTTCCGTGATTCAGCAGTCTTATGTCAGCCCGG
AGGACAGAACCTTTCTTCGAAACTCACAGTGCCTCGATGGAGTAGGTCGC
CAGCCATATGTTTGCTGTACAAGTGATCGCAGCTTTGGATCCCAGGAGGC
CACCTCCGCAGCCCCTCCTCCAACGACTACCAGTTCAAGTTCACGAGGTC
AAGACGGTCAAGCGGGTCTGGGCAACCTGCTGCCCTCGCCACCCAAGTGC
GGGCCCCACTCCTTCAGCAATAAGGTCTATAATGGCAACGACACTGCTAT
TGACGAGTTCAACTGGATGGCACTGCTTGAGTACGTGGATAGGGACGGCG
GGAACTCAGTTGCGGTGGCAGTTTGATCAACAATCGTTACGTTCTTACCG
CCGCCCATTGCGTCATTGGTGCGGTGGAAACGGAAGTAGGTCACCTAACT
ACCGTTCGGTTGGGGGAATACGATACCAGCAAGGACGTGGACTGCATAGA
TGACATTTGCAACCAGCCCATCCTACAATTGGGCATCGAACAGGCCACTG
TACATCCCCAATATGATCCTGCCAACAAGAACCGCATTCACGACATTGCC
TTATTGCGATTAGATCGGCCCGTTGTGCTTAATGAGTATATTCAGCCGGT
TTGTTTGCCTTTGGTAAGCACACGAATGGCAATCAATACCGGGGAGCTCT
TGGTGGTCAGCGGGTGGGGCCGAACCACAACAGCCCGCAAGAGCACCATA
AAGCAGCGATTGGATCTGCCGGTGAATGACCACGATTACTGCGCACGAAA
GTTCGCCACGAGGAATATCCACCTGATCAGTTCCCAGCTCTGTGTTGGCG
GGGAATTCTACCGCGACAGCTGTGATGGCGACTCCGGCGGACCGCTGATG
CGAAGGGGTTTTGACCAGGCTTGGTACCAGGAGGGCGTGGTCTCCTTTGG
CAACCGCTGCGGACTAGAGGGTTGGCCAGGTGTCTACACTCGGGTAGCCG
ACTACATGGACTGGATCGTGGAGACCATTCGTCCCTGAGCAGCGGAACGA
AGGCCGCTTTTGTTCTGATAATGTTTTAATTAAAGTCAAGTCGAGAGTGC
TCTTTGGGCTGGGCGCCCATCCTTTAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAA

SD07170.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Sp7-RD 1831 Sp7-RD 1..1827 1..1827 9135 100 Plus
Sp7-RA 1998 Sp7-RA 23..1853 1..1827 9070 99.7 Plus
Sp7-RC 2086 Sp7-RC 386..1941 276..1827 7695 99.7 Plus
Sp7-RC 2086 Sp7-RC 23..138 1..116 580 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3586796..3587336 116..656 2705 100 Plus
chr3R 27901430 chr3R 3589093..3589486 1432..1825 1970 100 Plus
chr3R 27901430 chr3R 3588067..3588454 655..1042 1940 100 Plus
chr3R 27901430 chr3R 3588695..3588981 1147..1433 1435 100 Plus
chr3R 27901430 chr3R 3585868..3585983 1..116 580 100 Plus
chr3R 27901430 chr3R 3588521..3588625 1042..1146 525 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:50:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7760736..7761276 116..656 2705 100 Plus
3R 32079331 3R 7763033..7763428 1432..1827 1980 100 Plus
3R 32079331 3R 7762007..7762394 655..1042 1940 100 Plus
3R 32079331 3R 7762635..7762921 1147..1433 1435 100 Plus
3R 32079331 3R 7759808..7759923 1..116 580 100 Plus
3R 32079331 3R 7762461..7762565 1042..1146 525 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7501567..7502107 116..656 2705 100 Plus
3R 31820162 3R 7503864..7504259 1432..1827 1980 100 Plus
3R 31820162 3R 7502838..7503225 655..1042 1940 100 Plus
3R 31820162 3R 7503466..7503752 1147..1433 1435 100 Plus
3R 31820162 3R 7500639..7500754 1..116 580 100 Plus
3R 31820162 3R 7503292..7503396 1042..1146 525 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:00:18 has no hits.

SD07170.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:01:36 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3585868..3585983 1..116 100 -> Plus
chr3R 3586797..3587334 117..654 100 -> Plus
chr3R 3588067..3588453 655..1041 100 -> Plus
chr3R 3588521..3588625 1042..1146 100 -> Plus
chr3R 3588695..3588981 1147..1433 100 -> Plus
chr3R 3589095..3589486 1434..1825 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:02:52 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RC 1..1176 567..1738 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:57:33 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RC 1..1176 567..1738 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:03:08 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RA 1..1176 567..1738 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:26:48 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RC 1..1176 567..1738 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:18 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RA 1..1176 567..1738 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:44:00 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RD 1..1825 1..1825 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:57:33 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RD 23..1847 1..1825 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:03:08 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RA 23..1851 1..1825 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:26:48 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RD 1..1825 1..1825 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:18 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
Sp7-RA 23..1851 1..1825 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:36 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7760737..7761274 117..654 100 -> Plus
3R 7762007..7762393 655..1041 100 -> Plus
3R 7762461..7762565 1042..1146 100 -> Plus
3R 7762635..7762921 1147..1433 100 -> Plus
3R 7763035..7763426 1434..1825 100   Plus
3R 7759808..7759923 1..116 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:36 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7760737..7761274 117..654 100 -> Plus
3R 7762007..7762393 655..1041 100 -> Plus
3R 7762461..7762565 1042..1146 100 -> Plus
3R 7762635..7762921 1147..1433 100 -> Plus
3R 7763035..7763426 1434..1825 100   Plus
3R 7759808..7759923 1..116 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:36 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7760737..7761274 117..654 100 -> Plus
3R 7762007..7762393 655..1041 100 -> Plus
3R 7762461..7762565 1042..1146 100 -> Plus
3R 7762635..7762921 1147..1433 100 -> Plus
3R 7763035..7763426 1434..1825 100   Plus
3R 7759808..7759923 1..116 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:03:08 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3585530..3585645 1..116 100 -> Plus
arm_3R 3586459..3586996 117..654 100 -> Plus
arm_3R 3587729..3588115 655..1041 100 -> Plus
arm_3R 3588183..3588287 1042..1146 100 -> Plus
arm_3R 3588357..3588643 1147..1433 100 -> Plus
arm_3R 3588757..3589148 1434..1825 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:04:02 Download gff for SD07170.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7501568..7502105 117..654 100 -> Plus
3R 7502838..7503224 655..1041 100 -> Plus
3R 7503292..7503396 1042..1146 100 -> Plus
3R 7503466..7503752 1147..1433 100 -> Plus
3R 7503866..7504257 1434..1825 100   Plus
3R 7500639..7500754 1..116 100 -> Plus

SD07170.pep Sequence

Translation from 566 to 1075

> SD07170.pep
MKSTRKVVGIFLATCLLPFTVLQNVAAQGSCRNPNQKQGQCLSIYDCQSL
LSVIQQSYVSPEDRTFLRNSQCLDGVGRQPYVCCTSDRSFGSQEATSAAP
PPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNW
MALLEYVDRDGGNSVAVAV*

SD07170.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17682-PA 394 GF17682-PA 1..164 1..161 482 65.2 Plus
Dana\GF16188-PA 418 GF16188-PA 4..190 12..166 243 33 Plus
Dana\GF23198-PA 392 GF23198-PA 26..152 24..161 206 35.2 Plus
Dana\GF18202-PA 393 GF18202-PA 27..150 29..156 192 38.1 Plus
Dana\GF16252-PA 399 GF16252-PA 30..152 29..156 154 32.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14174-PA 391 GG14174-PA 1..161 1..161 713 87 Plus
Dere\GG11948-PA 417 GG11948-PA 3..193 10..168 255 33 Plus
Dere\GG16913-PA 392 GG16913-PA 26..152 24..161 196 35.2 Plus
Dere\GG12275-PA 392 GG12275-PA 9..149 7..156 196 34.6 Plus
Dere\GG11914-PA 357 GG11914-PA 2..129 6..156 163 30.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18317-PA 379 GH18317-PA 3..151 30..161 355 49 Plus
Dgri\GH14281-PA 578 GH14281-PA 217..340 25..164 211 35.7 Plus
Dgri\GH18417-PA 435 GH18417-PA 24..204 31..156 186 29.8 Plus
Dgri\GH17229-PA 387 GH17229-PA 3..148 11..160 184 33.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Sp7-PF 391 CG3066-PF 1..161 1..161 846 98.8 Plus
Sp7-PE 391 CG3066-PE 1..161 1..161 846 98.8 Plus
Sp7-PA 391 CG3066-PA 1..161 1..161 846 98.8 Plus
CG9733-PB 417 CG9733-PB 3..193 10..168 260 33.5 Plus
CG9733-PA 418 CG9733-PA 25..194 31..168 255 35.2 Plus
MP1-PA 390 CG1102-PA 27..147 29..156 211 36.7 Plus
CG11313-PC 367 CG11313-PC 4..140 12..161 205 34.9 Plus
CG11313-PD 370 CG11313-PD 4..140 12..161 205 34.9 Plus
ea-PA 392 CG4920-PA 26..152 24..161 204 35.9 Plus
MP1-PE 400 CG1102-PE 27..157 29..156 199 33.6 Plus
MP1-PC 399 CG1102-PC 27..156 29..156 198 33.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:27:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24127-PA 389 GI24127-PA 7..161 16..161 336 47.5 Plus
Dmoj\GI24319-PA 436 GI24319-PA 21..210 31..168 222 32.5 Plus
Dmoj\GI24877-PA 392 GI24877-PA 31..152 25..161 187 32.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12453-PA 383 GL12453-PA 1..153 1..161 470 61.5 Plus
Dper\GL14056-PA 423 GL14056-PA 4..191 12..161 233 30.9 Plus
Dper\GL12316-PA 391 GL12316-PA 27..148 29..156 192 35.6 Plus
Dper\GL23240-PA 395 GL23240-PA 33..155 25..161 182 34.3 Plus
Dper\GL13652-PA 401 GL13652-PA 35..154 29..156 140 28.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:27:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27509-PA 383 GA27509-PA 1..153 1..161 474 62.1 Plus
Dpse\GA15903-PA 383 GA15903-PA 1..153 1..161 474 62.1 Plus
Dpse\GA15903-PC 153 GA15903-PC 1..152 1..160 468 61.9 Plus
Dpse\GA27509-PC 155 GA27509-PC 1..151 1..159 461 61.6 Plus
Dpse\GA21994-PA 423 GA21994-PA 4..191 12..161 233 30.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10972-PA 391 GM10972-PA 1..166 1..166 718 89.8 Plus
Dsec\GM12163-PA 418 GM12163-PA 4..194 12..168 252 33.9 Plus
Dsec\GM24220-PA 402 GM24220-PA 36..162 24..161 198 35.9 Plus
Dsec\GM10743-PA 186 GM10743-PA 27..150 29..157 189 35.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19946-PA 391 GD19946-PA 1..166 1..166 735 91.6 Plus
Dsim\GD17168-PA 418 GD17168-PA 4..192 12..168 240 30.9 Plus
Dsim\GD19011-PA 392 GD19011-PA 26..152 24..161 196 35.2 Plus
Dsim\GD19715-PA 392 GD19715-PA 27..149 29..156 189 36.2 Plus
Dsim\GD16858-PA 352 GD16858-PA 4..121 12..156 172 31.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10951-PA 386 GJ10951-PA 1..158 1..161 392 50.3 Plus
Dvir\GJ10404-PA 426 GJ10404-PA 13..188 25..156 234 34.1 Plus
Dvir\GJ24520-PA 877 GJ24520-PA 516..637 25..161 206 35.8 Plus
Dvir\GJ22783-PA 401 GJ22783-PA 27..154 29..156 164 37 Plus
Dvir\GJ14460-PA 396 GJ14460-PA 23..153 29..156 162 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:27:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12018-PA 384 GK12018-PA 1..154 1..161 369 49.1 Plus
Dwil\GK13136-PA 412 GK13136-PA 1..186 8..168 213 30 Plus
Dwil\GK11130-PA 392 GK11130-PA 2..152 4..161 190 31.9 Plus
Dwil\GK22647-PA 279 GK22647-PA 9..52 118..161 163 68.2 Plus
Dwil\GK10951-PA 391 GK10951-PA 24..148 29..156 154 30.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:27:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24940-PA 391 GE24940-PA 1..161 1..161 706 88.8 Plus
Dyak\GE23396-PA 417 GE23396-PA 3..193 10..168 249 34 Plus
Dyak\GE24296-PA 392 GE24296-PA 31..152 25..161 201 35 Plus
Dyak\GE23362-PA 364 GE23362-PA 4..137 12..161 190 31.1 Plus
Dyak\GE25404-PA 376 GE25404-PA 9..133 7..156 175 33.3 Plus

SD07170.hyp Sequence

Translation from 566 to 1075

> SD07170.hyp
MKSTRKVVGIFLATCLLPFTVLQNVAAQGSCRNPNQKQGQCLSIYDCQSL
LSVIQQSYVSPEDRTFLRNSQCLDGVGRQPYVCCTSDRSFGSQEATSAAP
PPTTTSSSSRGQDGQAGLGNLLPSPPKCGPHSFSNKVYNGNDTAIDEFNW
MALLEYVDRDGGNSVAVAV*

SD07170.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:54
Subject Length Description Subject Range Query Range Score Percent Strand
Sp7-PF 391 CG3066-PF 1..161 1..161 846 98.8 Plus
Sp7-PE 391 CG3066-PE 1..161 1..161 846 98.8 Plus
Sp7-PA 391 CG3066-PA 1..161 1..161 846 98.8 Plus
CG9733-PB 417 CG9733-PB 3..193 10..168 260 33.5 Plus
CG9733-PA 418 CG9733-PA 25..194 31..168 255 35.2 Plus