Clone SD07266 Report

Search the DGRC for SD07266

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:72
Well:66
Vector:pOT2
Associated Gene/TranscriptImpL2-RB
Protein status:SD07266.pep: gold
Preliminary Size:1702
Sequenced Size:1628

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15009 2001-01-01 Release 2 assignment
CG15009 2001-09-19 Blastp of sequenced clone
CG15009 2003-01-01 Sim4 clustering to Release 3
ImpL2 2008-04-29 Release 5.5 accounting
ImpL2 2008-08-15 Release 5.9 accounting
ImpL2 2008-12-18 5.12 accounting

Clone Sequence Records

SD07266.complete Sequence

1628 bp (1628 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060476

> SD07266.complete
TGAACACGACTTTTGAGAGCCGCCGAAGCCAACTGATCCGAAGTTAACTA
AGCCGATCCGCGATCCTCGCTTTTCAATTCGCCGTGAACCGCATTCGCAG
CAGCAATCCCCCCCAAAAACCAAAAACCAACACACCTTGACTCGAGTGTA
ATGTCGATGAACCGTGCGTATTCAAACGAGTGCCGCGCCAACCAGACAAC
CATCAAGAAGTACCAGACCAAGTCCACGTCCACATCGAAGGAGCACTGAT
ACCGCCACGAGGATCGAATGTGCCAAAGTAGTCAGCTAGATATTCGCTAC
GCCGCCTGAGATTAACACGCTTCCGCTACCCAATTACTCGATCCTTATCC
CGATCCTGAAGCGCCACTCCCGAGCACAGCACCCAGACGTTTCAATACGA
TCCATCCTCGTCGCCCAAGACAGACCGGCAAGCAGCCAAGATTCCACCAA
CACTGAGCTGCACGACCTCCAAGACGGCATCCAGCGCCGGACCTATGTCA
GTGCTAAGCCAGCTGCTGCTCAACTTCAACCAGAAAGCCCAGACCAGGAG
CCATCACAACATAGAGCTGATAAATTCGTTCATAACATAACGATAAGCCG
ACCTGCTTCTGCTTTACCTGATCTATCATCGTCCAACGTTGGGGAGAAAT
TTGCAAACATTTTTTACCGGAAGAGAAAAAAGAAATCAAATCAAAGGAAA
ATGAATTTACATGTGTGCGCCTTAGCGCTGCTGCTGTTCGGCAGCATCGC
CACTGTCCGCGGAAGAGCCGTGGACCTGGTAGACGATAGCAACGACGTGG
ATAACTCCATCGAGGCGGAGGAGGAGAAGCCACGCAACCGAGCCTTCGAA
GCCGACTGGCTCAAGTTCACCAAGACGCCGCCGACGAAGCTGCAGCAGGC
CGATGGAGCCACCATCGAGATCGTTTGCGAGATGATGGGCTCCCAAGTGC
CCAGCATCCAGTGGGTGGTGGGTCACCTGCCCCGCTCGGAGCTCGATGAT
CTGGACTCCAACCAGGTTGCCGAAGAGGCGCCCAGTGCCATTGTGCGCGT
CCGATCGTCGCATATCATCGACCACGTGCTGAGCGAGGCCCGCACCTACA
CGTGTGTGGGACGCACTGGCTCCAAGACCATCTATGCCAGCACTGTGGTG
CATCCTCCTCGCTCCTCTCGTCTGACGCCGGAGAAGACCTACCCGGGTGC
CCAGAAACCGCGAATCATCTACACCGAGAAGACGCATCTGGACCTCATGG
GCTCCAACATTCAGCTGCCCTGCCGCGTGCACGCCCGTCCCCGCGCCGAG
ATCACCTGGTTGAATAACGAGAACAAGGAGATCGTCCAAGGACATCGCCA
CAGGGTGCTGGCCAACGGCGATCTTCTGATCTCCGAGATCAAGTGGGAGG
ATATGGGCAACTACAAGTGCATAGCCCGCAACGTCGTCGGAAAGGATACC
GCCGATACCTTCGTGTATCCCGTACTTAATGAGGAAGACTAAAGATCCTA
CCACCAAATAAAAAACAAAAGGCTATTGGATTGACGACGGAAATTCATCT
AGTTAGTTAGATAGATCAAATGCCTTCGAAGATGCGTGAAAAGAAATGAA
ATATGCTTAGAAAAAAAAAAAAAAAAAA

SD07266.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2.a 2383 ImpL2.a 61..1688 1..1628 8110 99.8 Plus
ImpL2-RB 1757 ImpL2-RB 128..1755 1..1628 8110 99.8 Plus
ImpL2.c 1833 ImpL2.c 259..1190 697..1628 4630 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:57:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4224313..4225093 1477..697 3905 100 Minus
chr3L 24539361 chr3L 4225960..4226656 697..1 3485 100 Minus
chr3L 24539361 chr3L 4224105..4224237 1610..1478 665 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:50:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:57:10
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4224927..4225707 1477..697 3905 100 Minus
3L 28110227 3L 4226574..4227270 697..1 3485 100 Minus
3L 28110227 3L 4224701..4224851 1628..1478 725 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4224927..4225707 1477..697 3905 100 Minus
3L 28103327 3L 4226574..4227270 697..1 3485 100 Minus
3L 28103327 3L 4224701..4224851 1628..1478 725 98.6 Minus
Blast to na_te.dros performed on 2019-03-16 07:57:10 has no hits.

SD07266.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:58:18 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4224105..4224237 1478..1610 100 <- Minus
chr3L 4224313..4225092 698..1477 100 <- Minus
chr3L 4225960..4226656 1..697 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:02:58 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 690..1492 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:57:36 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 690..1492 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:50:03 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..801 695..1492 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:26:50 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RC 1..804 690..1492 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:46:16 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..801 695..1492 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:44:03 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RB 1..1610 1..1610 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:57:36 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RB 1..1610 1..1610 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:50:03 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RB 33..1642 1..1610 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:26:50 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RB 1..1610 1..1610 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:46:16 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RB 33..1642 1..1610 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:18 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224719..4224851 1478..1610 100 <- Minus
3L 4224927..4225706 698..1477 100 <- Minus
3L 4226574..4227270 1..697 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:18 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224719..4224851 1478..1610 100 <- Minus
3L 4224927..4225706 698..1477 100 <- Minus
3L 4226574..4227270 1..697 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:58:18 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224719..4224851 1478..1610 100 <- Minus
3L 4224927..4225706 698..1477 100 <- Minus
3L 4226574..4227270 1..697 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:50:03 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4224719..4224851 1478..1610 100 <- Minus
arm_3L 4224927..4225706 698..1477 100 <- Minus
arm_3L 4226574..4227270 1..697 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:04:05 Download gff for SD07266.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224927..4225706 698..1477 100 <- Minus
3L 4226574..4227270 1..697 100   Minus
3L 4224719..4224851 1478..1610 100 <- Minus

SD07266.hyp Sequence

Translation from 700 to 1491

> SD07266.hyp
MNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFE
ADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDD
LDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVV
HPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAE
ITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDT
ADTFVYPVLNEED*

SD07266.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2-PD 263 CG15009-PD 1..263 1..263 1375 100 Plus
ImpL2-PB 263 CG15009-PB 1..263 1..263 1375 100 Plus
ImpL2-PA 266 CG15009-PA 4..266 1..263 1375 100 Plus
ImpL2-PC 267 CG15009-PC 5..267 1..263 1375 100 Plus
Nrg-PH 1239 CG1634-PH 341..512 56..252 152 26.7 Plus

SD07266.pep Sequence

Translation from 700 to 1491

> SD07266.pep
MNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNRAFE
ADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSELDD
LDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYASTVV
HPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARPRAE
ITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVGKDT
ADTFVYPVLNEED*

SD07266.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23872-PA 267 GF23872-PA 1..267 1..263 1173 82.4 Plus
Dana\GF21814-PA 1407 GF21814-PA 341..512 56..252 166 27.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14204-PA 263 GG14204-PA 1..263 1..263 1399 98.9 Plus
Dere\GG18259-PA 1239 GG18259-PA 341..512 56..252 152 25.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15542-PA 276 GH15542-PA 1..276 1..263 1041 71 Plus
Dgri\GH24930-PA 1298 GH24930-PA 340..510 56..251 177 27.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:11
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2-PD 263 CG15009-PD 1..263 1..263 1375 100 Plus
ImpL2-PC 267 CG15009-PC 5..267 1..263 1375 100 Plus
ImpL2-PB 263 CG15009-PB 1..263 1..263 1375 100 Plus
ImpL2-PA 266 CG15009-PA 4..266 1..263 1375 100 Plus
Nrg-PH 1239 CG1634-PH 341..512 56..252 152 26.7 Plus
Nrg-PF 1239 CG1634-PF 341..512 56..252 152 26.7 Plus
Nrg-PD 1239 CG1634-PD 341..512 56..252 152 26.7 Plus
Nrg-PC 1239 CG1634-PC 341..512 56..252 152 26.7 Plus
Nrg-PA 1239 CG1634-PA 341..512 56..252 152 26.7 Plus
Nrg-PI 1302 CG1634-PI 341..512 56..252 152 26.7 Plus
Nrg-PE 1302 CG1634-PE 341..512 56..252 152 26.7 Plus
Nrg-PB 1302 CG1634-PB 341..512 56..252 152 26.7 Plus
Nrg-PG 1309 CG1634-PG 341..512 56..252 152 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16817-PA 272 GI16817-PA 1..272 1..262 1069 71.7 Plus
Dmoj\GI16006-PA 1302 GI16006-PA 349..519 56..251 170 28.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12728-PA 81 GL12728-PA 1..65 78..142 271 78.5 Plus
Dper\GL22653-PA 1309 GL22653-PA 340..511 56..252 148 26.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16789-PA 332 GA16789-PA 1..265 1..260 1082 78.5 Plus
Dpse\GA14061-PA 1309 GA14061-PA 340..511 56..252 150 26.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13995-PA 267 GM13995-PA 5..267 1..263 1394 98.5 Plus
Dsec\GM21680-PA 1305 GM21680-PA 341..512 56..252 149 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:23:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ImpL2-PA 266 GD13276-PA 4..266 1..263 1406 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:23:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12564-PA 332 GJ12564-PA 60..329 1..259 1015 70.7 Plus
Dvir\GJ18818-PA 1292 GJ18818-PA 340..511 56..252 170 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10204-PA 309 GK10204-PA 41..309 1..263 1024 70.4 Plus
Dwil\GK25863-PA 1304 GK25863-PA 340..511 56..252 154 26.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:23:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20632-PA 279 GE20632-PA 17..279 1..263 1390 98.1 Plus
Dyak\GE15791-PA 1239 GE15791-PA 341..512 56..252 151 25.9 Plus