Clone SD08134 Report

Search the DGRC for SD08134

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:81
Well:34
Vector:pOT2
Associated Gene/TranscriptCG10336-RA
Protein status:SD08134.pep: gold
Preliminary Size:1309
Sequenced Size:1150

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10336 2001-01-01 Release 2 assignment
CG10336 2002-05-30 Blastp of sequenced clone
CG10336 2003-01-01 Sim4 clustering to Release 3
CG10336 2008-04-29 Release 5.5 accounting
CG10336 2008-08-15 Release 5.9 accounting
CG10336 2008-12-18 5.12 accounting

Clone Sequence Records

SD08134.complete Sequence

1150 bp (1150 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118443

> SD08134.complete
TTTCGGCCACTAGTTCTATGGCATCCCTGTTCGGAGATGATGGTGTGGAT
GACCTATTCAATGACAACATTCCGACTGACCCGGATCAGCTGCCCAGCGA
TGGCGAAGGCGAAAAGCTGTTTGCGGACGACGAGGACAACGGCGTAGAAC
CTGGTAGCCAGGATGCCCAGATAGTGGAGCCTAAGAAGCGAGCTGTGAGA
AATCCCCGACCGCGACTCACTGTGGAAACACTTCGAGGTCCTCGTGGCAT
CCAGACCATCGAAGATTATTTTAAGGACATCAAATTCAAGGGCAAGGGTT
ACGAGAAAACCGATCTCGACGAGGTGCTTCGCCGCCTGCAGCACTGGGGC
CATCGTATGTATCCCACCTACACCTTTGACGATGTGCTTAACAATATCGA
ACGGCTGGGCAAGAAGAAACCCCTCCAAGTGCACATGGCGCGATATCGAC
TCGGTCAGCTGGAGCAGATGCGCGCCCACGAAGCGGAGGCCCTGGAGGAG
GCGCAGGATGAGCAACAGGAAGGTGCCGGCGATGAACCCTTTGATGAGTT
CGACGCCCTGCTAGGTGAACAGATTGCCATGTCCAGGCTGGCGCCTCCCA
GCCCGCAGCAGTGGAAAATGTCTACTGCTTCCAGTAACAGCACGCTGGCT
ACTCCGTCATTCTCCCGCGGCAATGCTGTAATGTCCACGCCGTACTCCGG
TGTAAATGCGACCTTCGACAGAAGTGGAGCTTCTGTGGCTCCGGCCTTCG
ATCGGAATGGAGCTCCGTTGGCATCGATGGACATCAGCGACTATGGTCAG
CCGCTGCCTCCCTCACAGCCTCCCACGCCGGCGGCTAAGAAATTATCCAA
CGAACAGATGGCCAGGATTGCGGAAAACCGCAGGCTGGCGCAGGAGCGAC
TTAAGGCCAAGCAGCAGCAGGAGAGCGGAAGTAAAAGTTAGTGTATATTT
ATGATATAAAAACGCATATTTTTATAATTTTCAAAGGATAATTTATAAAA
ATAAATGAATAAGCTACGTTGAAAGTTAATGCGCGGTACTTAATATCTAA
ATTGATTTTTCTGTACTTCGATCTTTGATGAATATCACTTTAAATATACC
CTTAATCGTATTAAAACCACTCGCATTAGTAAAAAAAAAAAAAAAAAAAA

SD08134.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10336-RA 1214 CG10336-RA 85..1214 1..1130 5650 100 Plus
CG10336-RC 1344 CG10336-RC 215..1344 1..1130 5650 100 Plus
CG10336.a 1344 CG10336.a 215..1344 1..1130 5650 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18688520..18689649 1..1130 5650 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:51:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18689777..18690906 1..1130 5650 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18689777..18690906 1..1130 5650 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:02:06 has no hits.

SD08134.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:03:11 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18688520..18689649 1..1130 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:04:10 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RC 1..924 18..941 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:35:38 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RC 1..924 18..941 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:03:56 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RA 1..924 18..941 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:27:14 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RC 1..924 18..941 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:54 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RA 1..924 18..941 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:07:18 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RC 131..1260 1..1130 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:35:38 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RC 131..1260 1..1130 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:03:56 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RA 87..1216 1..1130 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:27:14 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RC 131..1260 1..1130 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:54 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
CG10336-RA 87..1216 1..1130 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:11 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18689777..18690906 1..1130 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:11 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18689777..18690906 1..1130 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:03:11 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18689777..18690906 1..1130 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:03:56 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18689777..18690906 1..1130 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:59:42 Download gff for SD08134.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18689777..18690906 1..1130 100   Plus

SD08134.hyp Sequence

Translation from 2 to 940

> SD08134.hyp
SATSSMASLFGDDGVDDLFNDNIPTDPDQLPSDGEGEKLFADDEDNGVEP
GSQDAQIVEPKKRAVRNPRPRLTVETLRGPRGIQTIEDYFKDIKFKGKGY
EKTDLDEVLRRLQHWGHRMYPTYTFDDVLNNIERLGKKKPLQVHMARYRL
GQLEQMRAHEAEALEEAQDEQQEGAGDEPFDEFDALLGEQIAMSRLAPPS
PQQWKMSTASSNSTLATPSFSRGNAVMSTPYSGVNATFDRSGASVAPAFD
RNGAPLASMDISDYGQPLPPSQPPTPAAKKLSNEQMARIAENRRLAQERL
KAKQQQESGSKS*

SD08134.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG10336-PC 307 CG10336-PC 1..307 6..312 1598 100 Plus
CG10336-PA 307 CG10336-PA 1..307 6..312 1598 100 Plus

SD08134.pep Sequence

Translation from 17 to 940

> SD08134.pep
MASLFGDDGVDDLFNDNIPTDPDQLPSDGEGEKLFADDEDNGVEPGSQDA
QIVEPKKRAVRNPRPRLTVETLRGPRGIQTIEDYFKDIKFKGKGYEKTDL
DEVLRRLQHWGHRMYPTYTFDDVLNNIERLGKKKPLQVHMARYRLGQLEQ
MRAHEAEALEEAQDEQQEGAGDEPFDEFDALLGEQIAMSRLAPPSPQQWK
MSTASSNSTLATPSFSRGNAVMSTPYSGVNATFDRSGASVAPAFDRNGAP
LASMDISDYGQPLPPSQPPTPAAKKLSNEQMARIAENRRLAQERLKAKQQ
QESGSKS*

SD08134.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:20:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15066-PA 307 GF15066-PA 1..307 1..307 1185 79.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:20:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21125-PA 320 GG21125-PA 14..320 1..307 1470 93.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11605-PA 296 GH11605-PA 1..289 1..299 892 62.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG10336-PC 307 CG10336-PC 1..307 1..307 1598 100 Plus
CG10336-PA 307 CG10336-PA 1..307 1..307 1598 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:20:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17174-PA 294 GI17174-PA 1..294 1..306 981 64.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19629-PA 301 GL19629-PA 1..296 1..302 1093 72.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:20:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10251-PA 301 GA10251-PA 1..296 1..302 1034 73 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17286-PA 320 GM17286-PA 14..319 1..306 1470 95.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:20:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24149-PA 157 GD24149-PA 14..116 1..103 523 95.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17680-PA 297 GJ17680-PA 1..293 1..305 948 65.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:20:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24687-PA 302 GK24687-PA 1..298 1..298 1026 70.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:20:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13199-PA 320 GE13199-PA 14..320 1..307 1372 91.5 Plus