Clone SD08216 Report

Search the DGRC for SD08216

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:82
Well:16
Vector:pOT2
Associated Gene/TranscriptCG2034-RA
Protein status:SD08216.pep: gold
Preliminary Size:1123
Sequenced Size:1165

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2034 2002-01-01 Sim4 clustering to Release 2
CG2034 2002-05-18 Blastp of sequenced clone
CG2034 2003-01-01 Sim4 clustering to Release 3
CG2034 2008-04-29 Release 5.5 accounting
CG2034 2008-08-15 Release 5.9 accounting
CG2034 2008-12-18 5.12 accounting

Clone Sequence Records

SD08216.complete Sequence

1165 bp (1165 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119183

> SD08216.complete
CTTTAGCTCGGCAGCACTGGCAGCTTCAACAAAAAGCTTCAATTTAAAAT
AATATTTAAGTAGTCCCACAATAAATGCTAACAAAATGCTCTCCAACCTG
GTGGTGACCAAGCAGAAAGTGGTCCTCGTAATAGATGAGCTAAATCGGGA
GCGCATTGCCCCCAAGTTCATCGGCAGTCTGCTGCACGAGCAGGGACAGG
GGGCGGATACCATCAAGGCCCTGCCCACCGGCGTCAGCCTTAAGCACGTG
GCCACCTTCGAGGCACTGATCGACAAGTACGCCAACAACAACACTGGGAG
TACTACGGATTCCAACTCCACTGGCTTTAACGTCATCCTGCCAACATTGG
CAGACCTGCTGTGCTACCAGACGCCTGCTTTCATATTTGGCTTCCTCAAC
CGCCTACGCCGCTCGGACAATGTGCGTCGGGTGTTCCTTTGGGCCTCCCC
GCAGCACCTGCAGGATCCGCATGCCGACTACATCCTGGCTGGCTGCGAGT
ACCTGGCCGAGCTGGTCCTCCGACTGGAATCGGACAAACTACTCTCGCTG
ATATCACGCAAGCCGGGCGGAGGGGTGTCCAACAGGCGCTACTCCTGCGA
AGTCAGCAAAACCCAGTTCAAGGTGACGCCGCTGGACGGAGGACTGCCTG
CAGGTGCCTCCCCCAAGCAGCCCTCGCCCGAGGCGGAGCAGACCACAGAG
CCGGCCAGCAGCACCTTCAAAATCGAGCTTGACGAGGATGAAGTGTTGGC
CCGCAATGCACTCACCCTGCCATACGAACGCACATCCGAGCCGTCTGAGG
GAAACATAATATACACGCCCGATGCCGACGACGATTTCGACGAGGAGGAT
CCGGACGAGGATCTGTGCATCTAGGCTGCCCGCCAGCAGCGAACGGCAGT
ACAAATAGCCTTGGCTTTAAGTCTCCTTAAGTCTAACCTACTAAAACCAT
AAAATACCTGGAATTCCGGCCCCAAAGTTCCGCCTAGGGGTGTGTTCAAC
CTCGCCAGAGGAGCAGAATGAATCTTTGAACGACCACTTAGTACACGTAG
AATTGCTCATTTATTTTGGATAACTTGATATGTGAATCAAAAAATCGAAG
AAACTTGTGAATACATACAACTGAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAA

SD08216.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG2034-RA 1175 CG2034-RA 41..1164 1..1124 5575 99.7 Plus
oxt-RB 3582 oxt-RB 3454..3582 1124..996 645 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:52:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2257272..2257919 133..780 3210 99.7 Plus
chr3L 24539361 chr3L 2257981..2258324 780..1123 1720 100 Plus
chr3L 24539361 chr3L 2257071..2257209 1..139 650 97.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:52:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2257870..2258517 133..780 3225 99.8 Plus
3L 28110227 3L 2258579..2258923 780..1124 1725 100 Plus
3L 28110227 3L 2257669..2257807 1..139 650 97.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2257870..2258517 133..780 3225 99.8 Plus
3L 28103327 3L 2258579..2258923 780..1124 1725 100 Plus
3L 28103327 3L 2257669..2257807 1..139 650 97.8 Plus
Blast to na_te.dros performed on 2019-03-16 18:52:18 has no hits.

SD08216.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:53:13 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2257071..2257204 1..134 98 -> Plus
chr3L 2257274..2257919 135..780 99 -> Plus
chr3L 2257982..2258324 781..1123 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:04:19 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..789 86..874 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:11 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..789 86..874 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:27:28 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..789 86..874 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:33:10 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..789 86..874 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:53:09 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..789 86..874 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:15:07 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..1123 1..1123 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:11 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..1123 1..1123 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:27:28 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 27..1149 1..1123 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:33:10 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 1..1123 1..1123 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:53:09 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
CG2034-RA 27..1149 1..1123 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:13 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2257669..2257802 1..134 98 -> Plus
3L 2257872..2258517 135..780 99 -> Plus
3L 2258580..2258922 781..1123 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:13 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2257669..2257802 1..134 98 -> Plus
3L 2257872..2258517 135..780 99 -> Plus
3L 2258580..2258922 781..1123 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:53:13 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2257669..2257802 1..134 98 -> Plus
3L 2257872..2258517 135..780 99 -> Plus
3L 2258580..2258922 781..1123 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:27:28 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2257669..2257802 1..134 98 -> Plus
arm_3L 2257872..2258517 135..780 99 -> Plus
arm_3L 2258580..2258922 781..1123 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:35 Download gff for SD08216.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2257872..2258517 135..780 99 -> Plus
3L 2258580..2258922 781..1123 100   Plus
3L 2257669..2257802 1..134 98 -> Plus

SD08216.pep Sequence

Translation from 85 to 873

> SD08216.pep
MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANNNTGSTTDSNSTGFNVILPTLADLLCYQTPAFI
FGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLESD
KLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLPAGASPKQPSPEA
EQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSEGNIIYTPDADDD
FDEEDPDEDLCI*

SD08216.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:27:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24906-PA 272 GF24906-PA 1..272 1..262 968 74.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14850-PA 274 GG14850-PA 1..274 1..262 1135 86.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:27:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15002-PA 270 GH15002-PA 1..252 1..244 798 65.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG2034-PB 262 CG2034-PB 1..262 1..262 1350 100 Plus
CG2034-PA 262 CG2034-PA 1..262 1..262 1350 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13164-PA 266 GI13164-PA 1..266 1..262 853 69.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:27:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24641-PA 278 GL24641-PA 1..278 1..262 959 72.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15196-PA 276 GA15196-PA 1..276 1..262 955 72.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:27:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14475-PA 262 GM14475-PA 1..262 1..262 1339 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13669-PA 262 GD13669-PA 1..262 1..262 1352 97.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11938-PA 267 GJ11938-PA 1..249 1..244 833 68.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12538-PA 280 GK12538-PA 1..266 1..248 906 65.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20307-PA 274 GE20307-PA 1..274 1..262 1158 88.3 Plus

SD08216.hyp Sequence

Translation from 85 to 873

> SD08216.hyp
MLSNLVVTKQKVVLVIDELNRERIAPKFIGSLLHEQGQGADTIKALPTGV
SLKHVATFEALIDKYANNNTGSTTDSNSTGFNVILPTLADLLCYQTPAFI
FGFLNRLRRSDNVRRVFLWASPQHLQDPHADYILAGCEYLAELVLRLESD
KLLSLISRKPGGGVSNRRYSCEVSKTQFKVTPLDGGLPAGASPKQPSPEA
EQTTEPASSTFKIELDEDEVLARNALTLPYERTSEPSEGNIIYTPDADDD
FDEEDPDEDLCI*

SD08216.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG2034-PB 262 CG2034-PB 1..262 1..262 1350 100 Plus
CG2034-PA 262 CG2034-PA 1..262 1..262 1350 100 Plus