Clone SD08670 Report

Search the DGRC for SD08670

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:86
Well:70
Vector:pOT2
Associated Gene/TranscriptRpb10-RA
Protein status:SD08670.pep: gold
Preliminary Size:204
Sequenced Size:380

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13628 2002-01-01 Sim4 clustering to Release 2
CG13628 2002-05-18 Blastp of sequenced clone
CG13628 2003-01-01 Sim4 clustering to Release 3
Rpb10 2008-04-29 Release 5.5 accounting
Rpb10 2008-08-15 Release 5.9 accounting
Rpb10 2008-12-18 5.12 accounting

Clone Sequence Records

SD08670.complete Sequence

380 bp (380 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119184

> SD08670.complete
AAAAACATTGTTGTGATTGCACATTTTTCGTGATTTAACTAAGAATTAGA
GCCTGATCTACAAAATGATTATTCCAATCCGTTGTTTCACCTGCGGCAAG
GTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAATA
CACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTGCC
GTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACTAT
GCTCCTCTGGAGAAGTGAACGGCACAATGGAAACCATCCAAACTGGACTT
GGGAATAAAAACTCTAGATTTTATTGTAAAATTACAAATTAAAGCTTGAT
CGATAGCCCTAGAAAAAAAAAAAAAAAAAA

SD08670.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-RA 519 Rpb10-RA 83..446 1..364 1820 100 Plus
CG13630-RA 1340 CG13630-RA 1275..1340 364..299 330 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 20541015..20541218 159..362 1020 100 Plus
chr3R 27901430 chr3R 20540776..20540934 1..159 780 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:52:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:34:24
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24717795..24718000 159..364 1030 100 Plus
3R 32079331 3R 24717554..24717712 1..159 795 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 24458626..24458831 159..364 1030 100 Plus
3R 31820162 3R 24458385..24458543 1..159 795 100 Plus
Blast to na_te.dros performed on 2019-03-16 00:34:24 has no hits.

SD08670.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:35:19 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 20540776..20540934 1..159 99 -> Plus
chr3R 20541016..20541218 160..362 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:04:39 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..204 65..268 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:52:12 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..204 65..268 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:03 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..204 65..268 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:34:33 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..204 65..268 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:05:40 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..204 65..268 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:03:54 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..362 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:52:11 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..362 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:03 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 44..405 1..362 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:34:33 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 1..362 1..362 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:05:40 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
Rpb10-RA 44..405 1..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:35:19 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24717554..24717712 1..159 100 -> Plus
3R 24717796..24717998 160..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:35:19 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24717554..24717712 1..159 100 -> Plus
3R 24717796..24717998 160..362 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:35:19 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24717554..24717712 1..159 100 -> Plus
3R 24717796..24717998 160..362 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:03 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 20543276..20543434 1..159 100 -> Plus
arm_3R 20543518..20543720 160..362 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:16:17 Download gff for SD08670.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24458627..24458829 160..362 100   Plus
3R 24458385..24458543 1..159 100 -> Plus

SD08670.hyp Sequence

Translation from 64 to 267

> SD08670.hyp
MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLL
GHVDLIEKLLNYAPLEK*

SD08670.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-PA 67 CG13628-PA 1..67 1..67 360 100 Plus

SD08670.pep Sequence

Translation from 64 to 267

> SD08670.pep
MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLL
GHVDLIEKLLNYAPLEK*

SD08670.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17223-PA 67 GF17223-PA 1..67 1..67 348 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11312-PA 67 GG11312-PA 1..67 1..67 348 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18444-PA 67 GH18444-PA 1..67 1..67 348 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Rpb10-PA 67 CG13628-PA 1..67 1..67 360 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:26:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24021-PA 67 GI24021-PA 1..67 1..67 348 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13620-PA 67 GL13620-PA 1..67 1..67 348 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12420-PA 67 GA12420-PA 1..67 1..67 348 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26620-PA 67 GM26620-PA 1..67 1..67 348 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21123-PA 67 GD21123-PA 1..67 1..67 348 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:26:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23650-PA 67 GJ23650-PA 1..67 1..67 348 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14032-PA 67 GK14032-PA 1..67 1..67 345 98.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:26:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23508-PA 67 GE23508-PA 1..67 1..67 348 100 Plus