BDGP Sequence Production Resources |
Search the DGRC for SD08670
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 86 |
Well: | 70 |
Vector: | pOT2 |
Associated Gene/Transcript | Rpb10-RA |
Protein status: | SD08670.pep: gold |
Preliminary Size: | 204 |
Sequenced Size: | 380 |
Gene | Date | Evidence |
---|---|---|
CG13628 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13628 | 2002-05-18 | Blastp of sequenced clone |
CG13628 | 2003-01-01 | Sim4 clustering to Release 3 |
Rpb10 | 2008-04-29 | Release 5.5 accounting |
Rpb10 | 2008-08-15 | Release 5.9 accounting |
Rpb10 | 2008-12-18 | 5.12 accounting |
380 bp (380 high quality bases) assembled on 2002-05-18
GenBank Submission: AY119184
> SD08670.complete AAAAACATTGTTGTGATTGCACATTTTTCGTGATTTAACTAAGAATTAGA GCCTGATCTACAAAATGATTATTCCAATCCGTTGTTTCACCTGCGGCAAG GTCATTGGCAACAAGTGGGAGTCGTATTTGGGTCTCCTGCAAGCGGAATA CACCGAAGGAGATGCCCTGGATGCTTTGGGTCTAAAGAGGTACTGCTGCC GTCGCATGCTCCTGGGCCACGTGGATCTTATCGAAAAACTGCTCAACTAT GCTCCTCTGGAGAAGTGAACGGCACAATGGAAACCATCCAAACTGGACTT GGGAATAAAAACTCTAGATTTTATTGTAAAATTACAAATTAAAGCTTGAT CGATAGCCCTAGAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 20540776..20540934 | 1..159 | 99 | -> | Plus |
chr3R | 20541016..20541218 | 160..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..204 | 65..268 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..204 | 65..268 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..204 | 65..268 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..204 | 65..268 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..204 | 65..268 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..362 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..362 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 44..405 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 1..362 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Rpb10-RA | 44..405 | 1..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24717554..24717712 | 1..159 | 100 | -> | Plus |
3R | 24717796..24717998 | 160..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24717554..24717712 | 1..159 | 100 | -> | Plus |
3R | 24717796..24717998 | 160..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24717554..24717712 | 1..159 | 100 | -> | Plus |
3R | 24717796..24717998 | 160..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 20543276..20543434 | 1..159 | 100 | -> | Plus |
arm_3R | 20543518..20543720 | 160..362 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 24458627..24458829 | 160..362 | 100 | Plus | |
3R | 24458385..24458543 | 1..159 | 100 | -> | Plus |
Translation from 64 to 267
> SD08670.hyp MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLL GHVDLIEKLLNYAPLEK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb10-PA | 67 | CG13628-PA | 1..67 | 1..67 | 360 | 100 | Plus |
Translation from 64 to 267
> SD08670.pep MIIPIRCFTCGKVIGNKWESYLGLLQAEYTEGDALDALGLKRYCCRRMLL GHVDLIEKLLNYAPLEK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17223-PA | 67 | GF17223-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11312-PA | 67 | GG11312-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18444-PA | 67 | GH18444-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rpb10-PA | 67 | CG13628-PA | 1..67 | 1..67 | 360 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24021-PA | 67 | GI24021-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13620-PA | 67 | GL13620-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12420-PA | 67 | GA12420-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26620-PA | 67 | GM26620-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21123-PA | 67 | GD21123-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23650-PA | 67 | GJ23650-PA | 1..67 | 1..67 | 348 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14032-PA | 67 | GK14032-PA | 1..67 | 1..67 | 345 | 98.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE23508-PA | 67 | GE23508-PA | 1..67 | 1..67 | 348 | 100 | Plus |