Clone SD08737 Report

Search the DGRC for SD08737

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:87
Well:37
Vector:pOT2
Associated Gene/TranscriptPrx3-RA
Protein status:SD08737.pep: gold
Preliminary Size:1093
Sequenced Size:1010

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5826 2001-01-01 Release 2 assignment
CG5826 2003-01-01 Sim4 clustering to Release 3
CG5826 2003-03-19 Blastp of sequenced clone
Prx5037 2008-04-29 Release 5.5 accounting
Prx5037 2008-08-15 Release 5.9 accounting
Prx5037 2008-12-18 5.12 accounting

Clone Sequence Records

SD08737.complete Sequence

1010 bp (1010 high quality bases) assembled on 2003-03-19

GenBank Submission: BT006003

> SD08737.complete
TTTGTTTTCACTTTTTTTACGAAAAGTTCTGCCGGCTTCCCGTCAAATTC
TGACTTAATATAAGCCTTATATAAACGTTATCTATTAGAACAAGATGTCT
TTCGTAGCACGCTCACTGATTCGCAATGTGCCGCTGATGGGCAAGGCCAT
CCTGAGTCAGCAGAAACAGATTGCCGCCCGCCTCCTGCATCAAACCGCTC
CCCTTGCGGCAGTCCGCGTCCAGCAACCTGCTCCCGATTTCAAGGGTCTG
GCTGTGGTGGACAACAGCTTCCAGGAGGTTAAGCTGGAAGACTACAGGGG
CAAGTACCTGGTGCTCTTCTTCTACCCACTGGATTTCACATTCGTTTGCC
CCACTGAAATTGTTGCATTTAGCGAGAGGATCAAGGAGTTCCATGACATT
AACACCGAGGTTCTGGGCGTTTCCGTGGACTCCCACTTCAGCCATCTCAC
CTGGTGCAATGTCGACCGCAAGAACGGCGGAGTGGGCCAGCTGAAGTACC
CGCTCCTCTCCGATTTGACCAAGAAGATCTCTGCCGACTACGATGTGTTG
CTGGACAAGGAGGGCATCTCGCTGCGCGGCACCTTCATCATTGACCCCAA
TGGCATCCTGCGCCAGTACTCCATTAATGATTTGCCCGTGGGCCGATCCG
TCGACGAGGTTCTGCGCCTGATCAAAGCCTTCCAGTTCGTCGAGCAGCAC
GGAGAAGTCTGCCCGGCCAACTGGAATCCCAACTCGAATCCGGCTACCAT
TAAGCCCGATGTGGAGGAGTCCAAGAAGTACTTCAGCAAGCACGGCTAGA
GGATCATCTGATTATTTCTTAAACACCCTAAACATTCACTACACCAAAAG
ACTCGCAAAATAAAGAGGATAAAGATTGGAATTTTCTGTATAACAATTTA
AAAACAAAAACCCTAGGCATCGCACTAACTAATTATGCCTAATAAATCGA
TCTTATTTTTGTATGTTAGACAGATGTGGGAATAAAAAAAAAAAAAAAAA
AAAAAAAAAA

SD08737.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
Prx5037-RA 1108 Prx5037-RA 93..1047 1..955 4730 99.6 Plus
Jafrac1-RA 1013 Jafrac1-RA 219..283 290..354 220 89.2 Plus
Jafrac1-RB 1307 Jafrac1-RB 330..394 290..354 220 89.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13369554..13370200 983..337 3235 100 Minus
chr3R 27901430 chr3R 13370256..13370397 336..195 710 100 Minus
chr3R 27901430 chr3R 13370698..13370826 129..1 645 100 Minus
chr3R 27901430 chr3R 13370527..13370593 194..128 335 100 Minus
chrX 22417052 chrX 13222034..13222098 290..354 220 89.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:52:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17545235..17545853 955..337 3080 99.8 Minus
3R 32079331 3R 17545910..17546051 336..195 695 99.3 Minus
3R 32079331 3R 17546354..17546482 129..1 630 99.2 Minus
3R 32079331 3R 17546183..17546249 194..128 335 100 Minus
X 23542271 X 13331203..13331267 290..354 220 89.2 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:56:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17286066..17286684 955..337 3080 99.8 Minus
3R 31820162 3R 17286741..17286882 336..195 695 99.2 Minus
3R 31820162 3R 17287185..17287313 129..1 630 99.2 Minus
3R 31820162 3R 17287014..17287080 194..128 335 100 Minus
X 23527363 X 13339301..13339365 290..354 220 89.2 Plus
Blast to na_te.dros performed on 2019-03-15 19:49:58 has no hits.

SD08737.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:50:52 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13369554..13370200 337..983 100 <- Minus
chr3R 13370256..13370397 195..336 100 <- Minus
chr3R 13370527..13370593 128..194 100 <- Minus
chr3R 13370700..13370826 1..127 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:04:42 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5037-RA 1..705 95..799 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:46:03 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5037-RA 1..705 95..799 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:15:41 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx3-RA 1..705 95..799 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:37:30 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5037-RA 1..705 95..799 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:08:42 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx3-RA 1..705 95..799 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:57:21 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5037-RA 28..989 1..962 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:46:03 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5037-RA 28..989 1..962 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:15:41 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx3-RA 50..1004 1..955 99 == Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:37:31 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx5037-RA 28..989 1..962 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:08:42 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
Prx3-RA 50..1004 1..955 99 == Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:50:52 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17545235..17545853 337..955 99 <- Minus
3R 17545910..17546051 195..336 99 <- Minus
3R 17546183..17546249 128..194 100 <- Minus
3R 17546356..17546482 1..127 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:50:52 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17545235..17545853 337..955 99 <- Minus
3R 17545910..17546051 195..336 99 <- Minus
3R 17546183..17546249 128..194 100 <- Minus
3R 17546356..17546482 1..127 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:50:52 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17545235..17545853 337..955 99 <- Minus
3R 17545910..17546051 195..336 99 <- Minus
3R 17546183..17546249 128..194 100 <- Minus
3R 17546356..17546482 1..127 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:15:41 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13370957..13371575 337..955 99 <- Minus
arm_3R 13371632..13371773 195..336 99 <- Minus
arm_3R 13371905..13371971 128..194 100 <- Minus
arm_3R 13372078..13372204 1..127 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:07:37 Download gff for SD08737.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17286066..17286684 337..955 99 <- Minus
3R 17286741..17286882 195..336 99 <- Minus
3R 17287014..17287080 128..194 100 <- Minus
3R 17287187..17287313 1..127 99   Minus

SD08737.pep Sequence

Translation from 94 to 798

> SD08737.pep
MSFVARSLIRNVPLMGKAILSQQKQIAARLLHQTAPLAAVRVQQPAPDFK
GLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFH
DINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYD
VLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVE
QHGEVCPANWNPNSNPATIKPDVEESKKYFSKHG*

SD08737.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15932-PA 234 GF15932-PA 1..234 1..234 1173 93.2 Plus
Dana\GF24261-PA 244 GF24261-PA 44..242 32..233 656 59.9 Plus
Dana\GF19402-PA 194 GF19402-PA 3..191 41..231 612 57.1 Plus
Dana\GF23670-PA 196 GF23670-PA 4..194 40..233 531 50 Plus
Dana\GF12795-PA 220 GF12795-PA 1..200 40..232 255 34.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:43:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16768-PA 234 GG16768-PA 1..234 1..234 1226 98.3 Plus
Dere\GG14898-PA 242 GG14898-PA 43..241 32..233 657 60.4 Plus
Dere\GG17772-PA 194 GG17772-PA 3..190 41..230 613 57.9 Plus
Dere\GG15885-PA 196 GG15885-PA 4..192 40..230 535 50.3 Plus
Dere\GG24165-PA 220 GG24165-PA 1..200 40..232 242 33.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17487-PA 231 GH17487-PA 1..231 1..234 1075 85.1 Plus
Dgri\GH15986-PA 243 GH15986-PA 44..242 32..233 633 58.4 Plus
Dgri\GH14416-PA 195 GH14416-PA 4..194 42..234 510 46.4 Plus
Dgri\GH17696-PA 288 GH17696-PA 178..268 41..131 336 62.6 Plus
Dgri\GH20103-PA 220 GH20103-PA 1..195 40..229 228 32.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Prx3-PA 234 CG5826-PA 1..234 1..234 1215 100 Plus
Jafrac2-PC 242 CG1274-PC 43..241 32..233 641 60.4 Plus
Jafrac2-PB 242 CG1274-PB 43..241 32..233 641 60.4 Plus
Jafrac2-PA 242 CG1274-PA 43..241 32..233 641 60.4 Plus
Jafrac1-PE 194 CG1633-PE 3..190 41..230 594 57.9 Plus
Jafrac1-PD 194 CG1633-PD 3..190 41..230 594 57.9 Plus
Jafrac1-PC 194 CG1633-PC 3..190 41..230 594 57.9 Plus
Jafrac1-PA 194 CG1633-PA 3..190 41..230 594 57.9 Plus
Jafrac1-PB 194 CG1633-PB 3..190 41..230 594 57.9 Plus
CG6888-PA 196 CG6888-PA 4..194 40..233 517 50.5 Plus
Prx2540-2-PA 220 CG11765-PA 1..200 40..232 230 33 Plus
Prx2540-1-PA 220 CG12405-PA 1..200 40..232 229 33 Plus
CG12896-PA 220 CG12896-PA 1..200 40..232 227 32.5 Plus
Prx6005-PA 222 CG3083-PA 34..179 71..210 188 29.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:43:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22813-PA 233 GI22813-PA 1..233 1..234 1105 87.2 Plus
Dmoj\GI16636-PA 243 GI16636-PA 44..242 32..233 649 59.9 Plus
Dmoj\GI16105-PA 194 GI16105-PA 3..191 41..231 619 58.1 Plus
Dmoj\GI13545-PA 268 GI13545-PA 43..264 5..230 508 44.2 Plus
Dmoj\GI20198-PA 220 GI20198-PA 1..200 40..232 221 32.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13701-PA 233 GL13701-PA 1..233 1..234 1149 91.5 Plus
Dper\GL26916-PA 194 GL26916-PA 3..191 41..231 614 58.1 Plus
Dper\GL16320-PA 204 GL16320-PA 15..203 44..233 605 59.2 Plus
Dper\GL20930-PA 194 GL20930-PA 4..190 42..230 510 48.7 Plus
Dper\GL11593-PA 220 GL11593-PA 1..200 40..232 227 33.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19159-PA 233 GA19159-PA 1..233 1..234 1149 91.5 Plus
Dpse\GA11781-PA 243 GA11781-PA 44..242 32..233 646 59.9 Plus
Dpse\GA14060-PA 200 GA14060-PA 9..197 41..231 614 58.1 Plus
Dpse\GA28632-PA 194 GA28632-PA 4..190 42..230 518 49.2 Plus
Dpse\GA11614-PA 220 GA11614-PA 1..200 40..232 227 33.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:43:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16948-PA 234 GM16948-PA 1..234 1..234 1234 99.1 Plus
Dsec\GM14524-PA 242 GM14524-PA 43..241 32..233 653 60.4 Plus
Dsec\GM11621-PA 194 GM11621-PA 3..190 41..230 611 57.9 Plus
Dsec\GM25516-PA 196 GM25516-PA 4..195 40..234 533 50.3 Plus
Dsec\GM15357-PA 765 GM15357-PA 1..68 1..68 346 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20225-PA 234 GD20225-PA 1..234 1..234 1234 99.1 Plus
Dsim\GD13721-PA 242 GD13721-PA 43..241 32..233 654 60.4 Plus
Dsim\GD17115-PA 194 GD17115-PA 3..190 41..230 611 57.9 Plus
Dsim\GD14531-PA 196 GD14531-PA 4..195 40..234 533 50.3 Plus
Dsim\GD25983-PA 220 GD25983-PA 1..200 40..232 240 33.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22817-PA 233 GJ22817-PA 1..233 1..234 1105 86.3 Plus
Dvir\GJ12891-PA 244 GJ12891-PA 45..243 32..233 642 59.4 Plus
Dvir\GJ15754-PA 194 GJ15754-PA 3..191 41..231 608 57.1 Plus
Dvir\GJ11904-PA 195 GJ11904-PA 2..191 40..230 515 47.4 Plus
Dvir\GJ20147-PA 220 GJ20147-PA 1..200 40..232 223 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12986-PA 233 GK12986-PA 1..233 1..234 1110 87.2 Plus
Dwil\GK16580-PA 248 GK16580-PA 49..247 32..233 656 60.4 Plus
Dwil\GK25196-PA 213 GK25196-PA 1..210 20..231 638 54.7 Plus
Dwil\GK19651-PA 196 GK19651-PA 1..192 37..230 534 47.4 Plus
Dwil\GK20591-PA 196 GK20591-PA 1..192 37..230 533 47.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:43:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25263-PA 234 GE25263-PA 1..234 1..234 1221 97.9 Plus
Dyak\GE20352-PA 242 GE20352-PA 52..241 42..233 651 61.5 Plus
Dyak\Jafrac1-PA 194 GE17062-PA 3..190 41..230 611 57.9 Plus
Dyak\GE22230-PA 196 GE22230-PA 4..195 40..234 532 50.8 Plus
Dyak\GE19359-PA 220 GE19359-PA 1..200 40..232 240 33.8 Plus

SD08737.hyp Sequence

Translation from 94 to 798

> SD08737.hyp
MSFVARSLIRNVPLMGKAILSQQKQIAARLLHQTAPLAAVRVQQPAPDFK
GLAVVDNSFQEVKLEDYRGKYLVLFFYPLDFTFVCPTEIVAFSERIKEFH
DINTEVLGVSVDSHFSHLTWCNVDRKNGGVGQLKYPLLSDLTKKISADYD
VLLDKEGISLRGTFIIDPNGILRQYSINDLPVGRSVDEVLRLIKAFQFVE
QHGEVCPANWNPNSNPATIKPDVEESKKYFSKHG*

SD08737.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Prx3-PA 234 CG5826-PA 1..234 1..234 1215 100 Plus
Jafrac2-PC 242 CG1274-PC 43..241 32..233 641 60.4 Plus
Jafrac2-PB 242 CG1274-PB 43..241 32..233 641 60.4 Plus
Jafrac2-PA 242 CG1274-PA 43..241 32..233 641 60.4 Plus
Jafrac1-PE 194 CG1633-PE 3..190 41..230 594 57.9 Plus