Clone SD09607 Report

Search the DGRC for SD09607

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:96
Well:7
Vector:pOT2
Associated Gene/TranscriptSurf6-RA
Protein status:SD09607.pep: gold
Preliminary Size:1267
Sequenced Size:1175

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4510 2001-01-01 Release 2 assignment
CG4510 2002-06-12 Blastp of sequenced clone
Surf6 2008-04-29 Release 5.5 accounting
Surf6 2008-08-15 Release 5.9 accounting
Surf6 2008-12-18 5.12 accounting

Clone Sequence Records

SD09607.complete Sequence

1175 bp (1175 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122261

> SD09607.complete
CCTTGCTTAGCTGCACGTGTGCGTGCGTAAATAATAGTTTTATTGTTATT
TTACTCTCGAAAATGACCCAGGCGGAGATCGTGAAATGTCTGCGGGAGGA
GTATGAAATCGAACACAACAAGGATCAGAAGCCGGAGAAGGAGGACCTGC
CCGCCATCACCAAAAAGTTCTATCAGCGAGTCTTGGAACTGCTGACCATT
CACAAAGTGCCCTACTCCAAACAAGAAGATGAGGAGACCTACGAAGAGTA
CCTGCTGTCGGACACGGAGGAATCGGGAAACAAGAAAAAGAAACAACAGG
GAAAACTGAAAAACCAAGACTCCGACGACGAGGATGTAGAGGCACGCATT
GCCTCCATCAAGAACAAGCTGCGCCAGAAAAAGGGACCCACAACGGAGCG
ACAGCAGAAGCGACGCGAATCTAAAAAGCTTAAACGCAGCAAGGGCGTCC
AGAAACTGCTCCTCTCCTCGGCCAAAAACCTCAAAAACGAGAACGTCAAG
CACCAGAAACTGAAGAATGGCGTGGTGAAATCAGAACAGGAGACGGAGGA
CAGCAAGGAACAGATCCAGCCGGTCAAGGTGCAACCGGTTTACAACCAGG
AGGCCAAGATCGTCTACTCCAAGGTGGACTTTGCCGCCAATCCTGGAGGC
AAAGCCAAGAAGTCTCACCAAAACCCCAAGGAGATTCTGAAGAAGCTGCG
CGACACCAAGAAGCACCTAACCGAACTGCGCGAACAGGGCGAAACGGACA
AGGCGGCGGAGATCCAGACGGACATCGCCTGGCGCAACGCATTCGACAAG
GTCGAGGGCAAGAAGGTCAAGGACGACACCAAGCTGCTGCAAAAGGCCAT
CAAGAAGCGGCGCGTGGAGAAGAAGAAGTCCAAGACCAAGTGGACTGAAC
GCAAGCAGAAGGTGGAGCACGACAAGGAAAAGAGGCAAAAGAAGCGACAG
GAGAACCTGGAGAAGCGCAGCAAGGACAAGAAGAACCGGAAACTAAAGAC
GGCCAGCAAGAGGGGTCGCATCATACCCGGCTATTAACTATGCTTACTAT
AGCCCTTAAGTGTAAAGTAGTGTAAATGTATGCCACGTTGAAATTCAACT
CAGAATGCTTTAGAAAAAAAGTGATCTTTCTGAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

SD09607.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Surf6-RA 1195 Surf6-RA 61..1195 1..1135 5675 100 Plus
Surf6.a 1133 Surf6.a 70..1133 72..1135 5320 100 Plus
CG4538.g 4528 CG4538.g 1..904 232..1135 4520 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:07:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 15727598..15728503 1132..227 4530 100 Minus
chr3R 27901430 chr3R 15728552..15728783 232..1 1145 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:53:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 19903662..19904570 1135..227 4545 100 Minus
3R 32079331 3R 19904619..19904850 232..1 1145 99.6 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 19644493..19645401 1135..227 4545 100 Minus
3R 31820162 3R 19645450..19645681 232..1 1145 99.5 Minus
Blast to na_te.dros performed on 2019-03-15 23:07:26 has no hits.

SD09607.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:08:15 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 15727598..15728501 229..1132 100 <- Minus
chr3R 15728556..15728783 1..228 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:05:25 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 1..975 63..1037 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:21:56 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 1..975 63..1037 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:28:29 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 1..975 63..1037 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:12:45 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 1..975 63..1037 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:20:04 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 1..975 63..1037 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:48:17 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 18..1149 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:21:56 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 18..1149 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:28:29 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 18..1149 1..1132 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:12:45 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 18..1149 1..1132 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:20:04 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
Surf6-RA 19..1150 1..1132 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:15 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19903665..19904568 229..1132 100 <- Minus
3R 19904623..19904850 1..228 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:15 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19903665..19904568 229..1132 100 <- Minus
3R 19904623..19904850 1..228 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:08:15 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19903665..19904568 229..1132 100 <- Minus
3R 19904623..19904850 1..228 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:28:29 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 15729387..15730290 229..1132 100 <- Minus
arm_3R 15730345..15730572 1..228 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:27 Download gff for SD09607.complete
Subject Subject Range Query Range Percent Splice Strand
3R 19644496..19645399 229..1132 100 <- Minus
3R 19645454..19645681 1..228 100   Minus

SD09607.hyp Sequence

Translation from 2 to 1036

> SD09607.hyp
LLSCTCACVNNSFIVILLSKMTQAEIVKCLREEYEIEHNKDQKPEKEDLP
AITKKFYQRVLELLTIHKVPYSKQEDEETYEEYLLSDTEESGNKKKKQQG
KLKNQDSDDEDVEARIASIKNKLRQKKGPTTERQQKRRESKKLKRSKGVQ
KLLLSSAKNLKNENVKHQKLKNGVVKSEQETEDSKEQIQPVKVQPVYNQE
AKIVYSKVDFAANPGGKAKKSHQNPKEILKKLRDTKKHLTELREQGETDK
AAEIQTDIAWRNAFDKVEGKKVKDDTKLLQKAIKKRRVEKKKSKTKWTER
KQKVEHDKEKRQKKRQENLEKRSKDKKNRKLKTASKRGRIIPGY*

SD09607.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:06:48
Subject Length Description Subject Range Query Range Score Percent Strand
Surf6-PA 324 CG4510-PA 1..324 21..344 1649 100 Plus
rudhira-PE 2075 CG43154-PE 1374..1659 27..341 182 23.5 Plus
rudhira-PC 2075 CG43154-PC 1374..1659 27..341 182 23.5 Plus
rudhira-PE 2075 CG43154-PE 1328..1619 32..336 168 21.3 Plus
rudhira-PC 2075 CG43154-PC 1328..1619 32..336 168 21.3 Plus
rudhira-PE 2075 CG43154-PE 1323..1570 76..336 159 23.8 Plus
rudhira-PC 2075 CG43154-PC 1323..1570 76..336 159 23.8 Plus
CG2839-PA 826 CG2839-PA 446..747 31..332 154 15.6 Plus
eIF5B-PD 1090 CG10840-PD 74..376 41..337 154 21.1 Plus

SD09607.pep Sequence

Translation from 62 to 1036

> SD09607.pep
MTQAEIVKCLREEYEIEHNKDQKPEKEDLPAITKKFYQRVLELLTIHKVP
YSKQEDEETYEEYLLSDTEESGNKKKKQQGKLKNQDSDDEDVEARIASIK
NKLRQKKGPTTERQQKRRESKKLKRSKGVQKLLLSSAKNLKNENVKHQKL
KNGVVKSEQETEDSKEQIQPVKVQPVYNQEAKIVYSKVDFAANPGGKAKK
SHQNPKEILKKLRDTKKHLTELREQGETDKAAEIQTDIAWRNAFDKVEGK
KVKDDTKLLQKAIKKRRVEKKKSKTKWTERKQKVEHDKEKRQKKRQENLE
KRSKDKKNRKLKTASKRGRIIPGY*

SD09607.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:47:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17350-PA 329 GF17350-PA 1..329 1..324 1089 78.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:47:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\Surf6-PA 324 GG15764-PA 1..324 1..324 1554 94.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:47:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23294-PA 328 GH23294-PA 33..328 36..324 930 72 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
Surf6-PA 324 CG4510-PA 1..324 1..324 1649 100 Plus
rudhira-PE 2075 CG43154-PE 1374..1659 7..321 182 23.5 Plus
rudhira-PC 2075 CG43154-PC 1374..1659 7..321 182 23.5 Plus
rudhira-PE 2075 CG43154-PE 1328..1619 12..316 168 21.3 Plus
rudhira-PC 2075 CG43154-PC 1328..1619 12..316 168 21.3 Plus
rudhira-PE 2075 CG43154-PE 1323..1570 56..316 159 23.8 Plus
rudhira-PC 2075 CG43154-PC 1323..1570 56..316 159 23.8 Plus
CG2839-PA 826 CG2839-PA 446..747 11..312 154 15.6 Plus
eIF5B-PD 1090 CG10840-PD 74..376 21..317 154 21.1 Plus
eIF5B-PE 1108 CG10840-PE 74..376 21..317 154 21.1 Plus
eIF5B-PF 1144 CG10840-PF 74..376 21..317 154 21.1 Plus
eIF5B-PC 1144 CG10840-PC 74..376 21..317 154 21.1 Plus
eIF5B-PB 1144 CG10840-PB 74..376 21..317 154 21.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10326-PA 344 GI10326-PA 10..344 7..324 843 61.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12412-PA 316 GL12412-PA 1..316 10..324 954 71.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:47:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27658-PA 326 GA27658-PA 5..326 4..324 965 70.8 Plus
Dpse\Surf6-PA 326 GA18228-PA 5..326 4..324 963 70.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26886-PA 324 GM26886-PA 1..324 1..324 1478 95.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15089-PA 325 GD15089-PA 1..325 1..324 1459 94.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10181-PA 327 GJ10181-PA 1..327 1..324 987 68.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\Surf6-PA 326 GK22805-PA 1..326 1..324 1041 69.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25105-PA 324 GE25105-PA 1..324 1..324 1565 94.8 Plus