Clone SD10052 Report

Search the DGRC for SD10052

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:100
Well:52
Vector:pOT2
Associated Gene/TranscriptImpL2-RA
Protein status:SD10052.pep: gold
Preliminary Size:1324
Sequenced Size:1186

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15009 2004-03-24 Blastp of sequenced clone
ImpL2 2008-04-29 Release 5.5 accounting
ImpL2 2008-08-15 Release 5.9 accounting
ImpL2 2008-12-18 5.12 accounting

Clone Sequence Records

SD10052.complete Sequence

1186 bp (1186 high quality bases) assembled on 2004-03-24

GenBank Submission: BT012299

> SD10052.complete
ACTCGCCACATCTCGAGCAGAACGGAGCTCCACCGAGAATCGACCATATA
TATATATATTCACATATATATACAGAGCCGAGAGTATAACTGCAACTGCA
GCCTGAGTTTTAGTCCAAGTGAAATCGAAAGCCCACCTTAACGTATTCCA
TTTCCACCGGAAACTCCAGCCGAAGTTCTAGAACTCTAGTGAAAGTGCCA
ACGAAGCTTCGAGTGAACGTCATCCAAAAAACAAAAAATATGCAGAAAAT
GAATTTACATGTGTGCGCCTTAGCGCTGCTGCTGTTCGGCAGCATCGCCA
CTGTCCGCGGAAGAGCCGTGGACCTGGTAGACGATAGCAACGACGTGGAT
AACTCCATCGAGGCGGAGGAGGAGAAGCCACGCAACCGAGCCTTCGAAGC
CGACTGGCTCAAGTTCACCAAGACGCCGCCGACGAAGCTGCAGCAGGCCG
ATGGAGCCACCATCGAGATCGTTTGCGAGATGATGGGCTCCCAAGTGCCC
AGCATCCAGTGGGTGGTGGGTCACCTGCCCCGCTCGGAGCTCGATGATCT
GGACTCCAACCAGGTTGCCGAAGAGGCGCCCAGTGCCATTGTGCGCGTCC
GATCGTCGCATATCATCGACCACGTGCTGAGCGAGGCCCGCACCTACACG
TGTGTGGGACGCACTGGCTCCAAGACCATCTATGCCAGCACTGTGGTGCA
TCCTCCTCGCTCCTCTCGTCTGACGCCGGAGAAGACCTACCCGGGTGCCC
AGAAACCGCGAATCATCTACACCGAGAAGACGCATCTGGACCTCATGGGC
TCCAACATTCAGCTGCCCTGCCGCGTGCACGCCCGTCCCCGCGCCGAGAT
CACCTGGTTGAATAACGAGAACAAGGAGATCGTCCAAGGACATCGCCACA
GGGTGCTGGCCAACGGCGATCTTCTGATCTCCGAGATCAAGTGGGAGGAT
ATGGGCAACTACAAGTGCATAGCCCGCAACGTCGTCGGAAAGGATACCGC
CGATACCTTCGTGTATCCCGTACTTAATGAGGAAGACTAAAGATCCTACC
ACCAAATAAAAAACAAAAGGCTATTGGATTGACGACGGAAATTCATCTAG
TTAGTTAGATAGATCAAATGCCTTCGAAGATGCGTGAAAAGAAATGAAAT
ATGCTTAGAAAAAATACAAAAAAAAAAAAAAAAAAA

SD10052.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2.c 1833 ImpL2.c 15..1194 1..1180 5900 100 Plus
ImpL2.b 1885 ImpL2.b 15..1194 1..1180 5900 100 Plus
ImpL2.d 2002 ImpL2.d 184..1363 1..1180 5900 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:54:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4224313..4225097 1025..241 3925 100 Minus
chr3L 24539361 chr3L 4235289..4235533 245..1 1225 100 Minus
chr3L 24539361 chr3L 4224096..4224237 1167..1026 710 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:53:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:53:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4224927..4225711 1025..241 3925 100 Minus
3L 28110227 3L 4235903..4236147 245..1 1225 100 Minus
3L 28110227 3L 4224697..4224851 1180..1026 775 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4224927..4225711 1025..241 3925 100 Minus
3L 28103327 3L 4235903..4236147 245..1 1225 100 Minus
3L 28103327 3L 4224697..4224851 1180..1026 775 100 Minus
Blast to na_te.dros performed on 2019-03-15 16:53:59 has no hits.

SD10052.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:55:11 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4224105..4224237 1026..1158 100 <- Minus
chr3L 4224313..4225092 246..1025 100 <- Minus
chr3L 4235289..4235533 1..245 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:56:34 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..801 240..1040 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:39:03 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..801 240..1040 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:12:38 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..801 240..1040 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:22:49 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..801 240..1040 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:20:17 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..801 240..1040 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:56:33 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..1167 1..1167 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:39:03 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..1167 1..1167 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:12:38 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..1167 1..1167 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:22:49 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..1167 1..1167 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:20:17 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
ImpL2-RA 1..1167 1..1167 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:11 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224710..4224851 1026..1167 100 <- Minus
3L 4224927..4225706 246..1025 100 <- Minus
3L 4235903..4236147 1..245 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:11 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224710..4224851 1026..1167 100 <- Minus
3L 4224927..4225706 246..1025 100 <- Minus
3L 4235903..4236147 1..245 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:55:11 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224710..4224851 1026..1167 100 <- Minus
3L 4224927..4225706 246..1025 100 <- Minus
3L 4235903..4236147 1..245 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:12:38 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4224710..4224851 1026..1167 100 <- Minus
arm_3L 4224927..4225706 246..1025 100 <- Minus
arm_3L 4235903..4236147 1..245 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:00:13 Download gff for SD10052.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4224927..4225706 246..1025 100 <- Minus
3L 4235903..4236147 1..245 100   Minus
3L 4224710..4224851 1026..1167 100 <- Minus

SD10052.pep Sequence

Translation from 239 to 1039

> SD10052.pep
MQKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNR
AFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSE
LDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYAS
TVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARP
RAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVG
KDTADTFVYPVLNEED*

SD10052.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:34:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23872-PA 267 GF23872-PA 1..267 4..266 1175 82.4 Plus
Dana\GF21814-PA 1407 GF21814-PA 341..512 59..255 167 27.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:34:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14204-PA 263 GG14204-PA 1..263 4..266 1401 98.9 Plus
Dere\GG18259-PA 1239 GG18259-PA 341..512 59..255 152 25.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15542-PA 276 GH15542-PA 1..276 4..266 1042 71 Plus
Dgri\GH24930-PA 1298 GH24930-PA 340..510 59..254 177 27.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2-PA 266 CG15009-PA 1..266 1..266 1390 100 Plus
ImpL2-PC 267 CG15009-PC 4..267 3..266 1380 100 Plus
ImpL2-PD 263 CG15009-PD 1..263 4..266 1375 100 Plus
ImpL2-PB 263 CG15009-PB 1..263 4..266 1375 100 Plus
Nrg-PH 1239 CG1634-PH 341..512 59..255 152 26.7 Plus
Nrg-PF 1239 CG1634-PF 341..512 59..255 152 26.7 Plus
Nrg-PD 1239 CG1634-PD 341..512 59..255 152 26.7 Plus
Nrg-PC 1239 CG1634-PC 341..512 59..255 152 26.7 Plus
Nrg-PA 1239 CG1634-PA 341..512 59..255 152 26.7 Plus
Nrg-PI 1302 CG1634-PI 341..512 59..255 152 26.7 Plus
Nrg-PE 1302 CG1634-PE 341..512 59..255 152 26.7 Plus
Nrg-PB 1302 CG1634-PB 341..512 59..255 152 26.7 Plus
Nrg-PG 1309 CG1634-PG 341..512 59..255 152 26.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:34:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16817-PA 272 GI16817-PA 1..272 4..265 1068 71.7 Plus
Dmoj\GI16006-PA 1302 GI16006-PA 349..519 59..254 170 28.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:34:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12728-PA 81 GL12728-PA 1..65 81..145 272 78.5 Plus
Dper\GL22653-PA 1309 GL22653-PA 340..511 59..255 148 26.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16789-PA 332 GA16789-PA 1..265 4..263 1082 78.5 Plus
Dpse\GA14061-PA 1309 GA14061-PA 340..511 59..255 151 26.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:34:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13995-PA 267 GM13995-PA 4..267 3..266 1399 98.5 Plus
Dsec\GM21680-PA 1305 GM21680-PA 341..512 59..255 149 25.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:34:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\ImpL2-PA 266 GD13276-PA 1..266 1..266 1422 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12564-PA 332 GJ12564-PA 59..329 3..262 1021 70.8 Plus
Dvir\GJ18818-PA 1292 GJ18818-PA 340..511 59..255 169 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:34:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10204-PA 309 GK10204-PA 40..309 3..266 1030 70.5 Plus
Dwil\GK25863-PA 1304 GK25863-PA 340..511 59..255 154 26.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:34:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20632-PA 279 GE20632-PA 15..279 2..266 1397 97.7 Plus
Dyak\GE15791-PA 1239 GE15791-PA 341..512 59..255 151 25.9 Plus

SD10052.hyp Sequence

Translation from 239 to 1039

> SD10052.hyp
MQKMNLHVCALALLLFGSIATVRGRAVDLVDDSNDVDNSIEAEEEKPRNR
AFEADWLKFTKTPPTKLQQADGATIEIVCEMMGSQVPSIQWVVGHLPRSE
LDDLDSNQVAEEAPSAIVRVRSSHIIDHVLSEARTYTCVGRTGSKTIYAS
TVVHPPRSSRLTPEKTYPGAQKPRIIYTEKTHLDLMGSNIQLPCRVHARP
RAEITWLNNENKEIVQGHRHRVLANGDLLISEIKWEDMGNYKCIARNVVG
KDTADTFVYPVLNEED*

SD10052.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
ImpL2-PA 266 CG15009-PA 1..266 1..266 1390 100 Plus
ImpL2-PC 267 CG15009-PC 4..267 3..266 1380 100 Plus
ImpL2-PD 263 CG15009-PD 1..263 4..266 1375 100 Plus
ImpL2-PB 263 CG15009-PB 1..263 4..266 1375 100 Plus
Nrg-PH 1239 CG1634-PH 341..512 59..255 152 26.7 Plus