Clone SD10877 Report

Search the DGRC for SD10877

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:108
Well:77
Vector:pOT2
Associated Gene/TranscriptCG8372-RA
Protein status:SD10877.pep: gold
Preliminary Size:2520
Sequenced Size:770

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8372 2001-01-01 Release 2 assignment
CG8372 2001-07-04 Blastp of sequenced clone
CG8372 2003-01-01 Sim4 clustering to Release 3
CG8372 2008-04-29 Release 5.5 accounting
CG8372 2008-08-15 Release 5.9 accounting
CG8372 2008-12-18 5.12 accounting

Clone Sequence Records

SD10877.complete Sequence

770 bp (770 high quality bases) assembled on 2001-07-04

GenBank Submission: AY052149

> SD10877.complete
TGAACTGCGACTGCTTTATTTTCTCCTTATCGTACAATTAAAGCCCAATT
GGAATTGTTAGCGACTCGTTTCATGGGCATTACGGCCGGAAAGACCTCCG
CAGCGGCAACAGTCCGAGGACGTTCAGATCTCGATGGCCAGTTCCGGAGG
AGGAGCCGGCAATGGCGTTCCGGATAGACTGCCTCCGATCAACGTAAAGG
ACCAACGCTTCCCCTACTGCATCGTTTGGACTCCCATTCCGGTTCTCACC
TGGCTGATGCCCATGATCGGACATATGGGCATTTGCACTTCGTCCGGTGT
GATTCGTGACTTCGCCGGCCCCTACTTCGTATCAGAGGACAACATGGCGT
TTGGAAGACCCACCCGGTACATAAGGTTGCATCCCAAGCACATGGTGGGC
GGCAGTTACGCCTGGGACGAGGCGGTCTCCAAAGCATCTGTGCTCTACGG
CACCCGCATCCACAATATCTTCTGTGACAACTGCCACTCGCATGTGGCAA
CGGCACTCATCTACATGCGCTACTACGACAGCACCGCATGGAACATGATT
ATCCTCAGCATGTGGCTCTTTGTCTGCGGCCGCTACGTCGGAATAGGGGG
TTTTATTAAGACCTGGCTGCCGTTTGCCATTCTCCTGTCCATCTTCACCA
TTCTGGGCATCTATTTTTAATATCCATATCTATATCAAATGCTATCAATG
TACAAATCTATGTACATATGACGTCCAATAAAGGATTCATTCATTTATGT
AAAAAAAAAAAAAAAAAAAA

SD10877.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-RA 863 CG8372-RA 74..824 1..751 3695 99.4 Plus
CG8372-RB 843 CG8372-RB 190..843 97..750 3225 99.5 Plus
CG8372-RB 843 CG8372-RB 20..115 1..96 465 98.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:18:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8211019..8211672 750..97 3240 99.7 Minus
chr2L 23010047 chr2L 8211747..8211842 96..1 480 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:54:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8212038..8212692 751..97 3230 99.5 Minus
2L 23513712 2L 8212767..8212862 96..1 465 99 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:48:09
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8212038..8212692 751..97 3230 99.5 Minus
2L 23513712 2L 8212767..8212862 96..1 465 98.9 Minus
Blast to na_te.dros performed on 2019-03-16 20:18:00 has no hits.

SD10877.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:18:47 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8211019..8211672 97..750 99 <- Minus
chr2L 8211747..8211842 1..96 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:06:49 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 15..591 91..670 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:11:31 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 15..591 91..670 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:59:46 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 15..591 91..670 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:42:31 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 15..591 91..670 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:57:34 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RB 15..591 91..670 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:03:09 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RA 20..769 1..750 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:11:31 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RA 20..769 1..750 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:59:46 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RA 41..790 1..750 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:42:31 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RA 20..769 1..750 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:57:34 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
CG8372-RA 41..790 1..750 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:47 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8212039..8212692 97..750 99 <- Minus
2L 8212767..8212862 1..96 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:47 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8212039..8212692 97..750 99 <- Minus
2L 8212767..8212862 1..96 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:18:47 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8212039..8212692 97..750 99 <- Minus
2L 8212767..8212862 1..96 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:59:46 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8212039..8212692 97..750 99 <- Minus
arm_2L 8212767..8212862 1..96 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:20:12 Download gff for SD10877.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8212767..8212862 1..96 98   Minus
2L 8212039..8212692 97..750 99 <- Minus

SD10877.pep Sequence

Translation from 133 to 669

> SD10877.pep
MASSGGGAGNGVPDRLPPINVKDQRFPYCIVWTPIPVLTWLMPMIGHMGI
CTSSGVIRDFAGPYFVSEDNMAFGRPTRYIRLHPKHMVGGSYAWDEAVSK
ASVLYGTRIHNIFCDNCHSHVATALIYMRYYDSTAWNMIILSMWLFVCGR
YVGIGGFIKTWLPFAILLSIFTILGIYF*

SD10877.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 12:38:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14628-PA 196 GF14628-PA 30..196 12..178 756 80.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23467-PA 196 GG23467-PA 30..196 12..178 807 90.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 12:38:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10250-PA 190 GH10250-PA 18..190 6..178 707 74.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:39:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-PA 178 CG8372-PA 1..178 1..178 982 100 Plus
CG8372-PB 196 CG8372-PB 19..196 1..178 982 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 12:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15419-PA 190 GI15419-PA 13..190 1..178 711 69.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:38:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19395-PA 195 GL19395-PA 25..195 8..178 734 76.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21028-PA 195 GA21028-PA 25..195 8..178 734 76.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:38:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13133-PA 196 GM13133-PA 19..196 1..178 896 93.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22432-PA 196 GD22432-PA 19..196 1..178 917 95.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:38:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17280-PA 193 GJ17280-PA 21..193 6..178 687 75.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14979-PA 202 GK14979-PA 27..202 1..178 779 80.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:38:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11124-PA 196 GE11124-PA 30..196 12..178 817 91.6 Plus

SD10877.hyp Sequence

Translation from 133 to 669

> SD10877.hyp
MASSGGGAGNGVPDRLPPINVKDQRFPYCIVWTPIPVLTWLMPMIGHMGI
CTSSGVIRDFAGPYFVSEDNMAFGRPTRYIRLHPKHMVGGSYAWDEAVSK
ASVLYGTRIHNIFCDNCHSHVATALIYMRYYDSTAWNMIILSMWLFVCGR
YVGIGGFIKTWLPFAILLSIFTILGIYF*

SD10877.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG8372-PA 178 CG8372-PA 1..178 1..178 982 100 Plus
CG8372-PB 196 CG8372-PB 19..196 1..178 982 100 Plus