Clone SD11293 Report

Search the DGRC for SD11293

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:112
Well:93
Vector:pOT2
Associated Gene/TranscriptRfC3-RA
Protein status:SD11293.pep: gold
Preliminary Size:1050
Sequenced Size:1136

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5313 2002-01-01 Sim4 clustering to Release 2
CG5313 2002-05-18 Blastp of sequenced clone
CG5313 2003-01-01 Sim4 clustering to Release 3
RfC3 2008-04-29 Release 5.5 accounting
RfC3 2008-08-15 Release 5.9 accounting
RfC3 2008-12-18 5.12 accounting

Clone Sequence Records

SD11293.complete Sequence

1136 bp (1136 high quality bases) assembled on 2002-05-18

GenBank Submission: AY119188

> SD11293.complete
CTTCCATGCGCATTTTATTGTATTAAATTTCTACCAATATATCAAATTAT
AGTTATGTCGGAAACCAGTGGACCCGCAGTGCGCATGCCTTGGGTGGAAA
AGTACAGACCAAGCGGTCTCGATGATTTGATATCTCACGAGGAAATAATA
TCAACAATAACCCGCTTTATAAGCCGCAAGCAGCTGCCCCATTTGCTGTT
CTACGGACCACCTGGCACGGGAAAAACGAGTACAATCCTGGCCTGCGCTC
GCCAATTGTATTCCCCTCAGCAGTTCAAGTCCATGGTCCTGGAGCTGAAT
GCCTCAGATGACCGAGGCATTGGGATTGTGCGCGGTCAAATCCTTAACTT
CGCGTCCACACGCACCATTTTCTGCGACACCTTTAAGCTGATCATTTTGG
ACGAGGCCGATGCCATGACCAACGATGCCCAGAATGCCCTGCGCCGCATA
ATTGAGAAATATACGGACAACGTGCGCTTCTGTGTGATTTGCAATTATTT
GAGCAAAATCATTCCGGCCCTGCAGTCGCGTTGCACCCGTTTTCGGTTCG
CTCCATTATCCCAGGATCAGATGATGCCGCGACTAGAAAAAATCATCGAA
GCCGAAGCTGTTCAGATAACTGAGGACGGCAAGCGGGCACTGCTGACCCT
GGCCAAAGGTGATATGAGAAAGGTCTTGAACGTCCTGCAGAGTACCGTGA
TGGCATTTGATACGGTCAACGAGGATAACGTCTACATGTGCGTGGGCTAT
CCGTTGAGGCAGGATATTGAACAGATATTGAAGGCCTTGCTATCTGGCAG
TAGCTTGGAGGACTCCTTCAAAACTGTCGAAAGTGCCAAGTACGCAAGAG
GTCTCGCTCTGGAAGACATCATTACAGAATTGCATTTGTTCGTTATGAGA
CTTGAGCTGCCTATGTCGGTCATGAACAAGCTTATTGTAAAGCTAGCTCA
GATCGAGGAGAGATTGGCCAAAGGATGTACAGAAGTGGCTCAAACTGCAG
CTCTGGTAGCCGCCTTCTTTATTTGCCGAGATATGGTTTCAATGGAGAAG
TGAAACAATGTGTACTCCAATAATAGGTTAGAATTAAATTATAAATACAA
AAACATAAAACACAAAAAAAAAAAAAAAAAAAAAAA

SD11293.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:00:54
Subject Length Description Subject Range Query Range Score Percent Strand
RfC3-RA 1213 RfC3-RA 58..1172 1..1115 5440 99.1 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10418330..10418780 158..608 2180 98.9 Plus
chr2L 23010047 chr2L 10419251..10419462 902..1113 1060 100 Plus
chr2L 23010047 chr2L 10418842..10419055 610..823 1040 99.1 Plus
chr2L 23010047 chr2L 10418061..10418153 1..93 450 98.9 Plus
chr2L 23010047 chr2L 10419118..10419195 824..901 360 97.4 Plus
chr2L 23010047 chr2L 10418208..10418273 92..157 330 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:54:38 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10419480..10419930 158..608 2195 99.1 Plus
2L 23513712 2L 10420401..10420614 902..1115 1070 100 Plus
2L 23513712 2L 10419992..10420205 610..823 1040 99.1 Plus
2L 23513712 2L 10419211..10419303 1..93 465 100 Plus
2L 23513712 2L 10420268..10420345 824..901 360 97.4 Plus
2L 23513712 2L 10419358..10419423 92..157 330 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10419480..10419930 158..608 2195 99.1 Plus
2L 23513712 2L 10420401..10420614 902..1115 1070 100 Plus
2L 23513712 2L 10419992..10420205 610..823 1040 99 Plus
2L 23513712 2L 10419211..10419303 1..93 465 100 Plus
2L 23513712 2L 10420268..10420345 824..901 360 97.4 Plus
2L 23513712 2L 10419358..10419423 92..157 330 100 Plus
Blast to na_te.dros performed on 2019-03-16 08:37:22 has no hits.

SD11293.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:38:22 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10418061..10418152 1..92 98 -> Plus
chr2L 10418209..10418273 93..157 100 -> Plus
chr2L 10418330..10418780 158..608 98 -> Plus
chr2L 10418841..10419055 609..823 98 -> Plus
chr2L 10419118..10419195 824..901 97 -> Plus
chr2L 10419251..10419462 902..1113 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:07:08 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 1..999 55..1053 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:41:19 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 1..999 55..1053 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:51:53 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 1..999 55..1053 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:33:17 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 1..999 55..1053 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:44:51 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 1..999 55..1053 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:15:15 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 1..1113 1..1113 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:41:19 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 22..1134 1..1113 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:51:53 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 22..1134 1..1113 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:33:17 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 1..1113 1..1113 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:44:51 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
RfC3-RA 22..1134 1..1113 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:22 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10419991..10420205 609..823 98 -> Plus
2L 10420268..10420345 824..901 97 -> Plus
2L 10419480..10419930 158..608 99 -> Plus
2L 10419211..10419302 1..92 100 -> Plus
2L 10419359..10419423 93..157 100 -> Plus
2L 10420401..10420612 902..1113 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:22 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10419991..10420205 609..823 98 -> Plus
2L 10420268..10420345 824..901 97 -> Plus
2L 10419480..10419930 158..608 99 -> Plus
2L 10419211..10419302 1..92 100 -> Plus
2L 10419359..10419423 93..157 100 -> Plus
2L 10420401..10420612 902..1113 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:38:22 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10419991..10420205 609..823 98 -> Plus
2L 10420268..10420345 824..901 97 -> Plus
2L 10419480..10419930 158..608 99 -> Plus
2L 10419211..10419302 1..92 100 -> Plus
2L 10419359..10419423 93..157 100 -> Plus
2L 10420401..10420612 902..1113 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:51:53 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10419991..10420205 609..823 98 -> Plus
arm_2L 10420268..10420345 824..901 97 -> Plus
arm_2L 10420401..10420612 902..1113 100   Plus
arm_2L 10419211..10419302 1..92 100 -> Plus
arm_2L 10419359..10419423 93..157 100 -> Plus
arm_2L 10419480..10419930 158..608 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:05:43 Download gff for SD11293.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10419480..10419930 158..608 99 -> Plus
2L 10419991..10420205 609..823 98 -> Plus
2L 10420268..10420345 824..901 97 -> Plus
2L 10420401..10420612 902..1113 100   Plus
2L 10419211..10419302 1..92 100 -> Plus
2L 10419359..10419423 93..157 100 -> Plus

SD11293.hyp Sequence

Translation from 0 to 1052

> SD11293.hyp
LPCAFYCIKFLPIYQIIVMSETSGPAVRMPWVEKYRPSGLDDLISHEEII
STITRFISRKQLPHLLFYGPPGTGKTSTILACARQLYSPQQFKSMVLELN
ASDDRGIGIVRGQILNFASTRTIFCDTFKLIILDEADAMTNDAQNALRRI
IEKYTDNVRFCVICNYLSKIIPALQSRCTRFRFAPLSQDQMMPRLEKIIE
AEAVQITEDGKRALLTLAKGDMRKVLNVLQSTVMAFDTVNEDNVYMCVGY
PLRQDIEQILKALLSGSSLEDSFKTVESAKYARGLALEDIITELHLFVMR
LELPMSVMNKLIVKLAQIEERLAKGCTEVAQTAALVAAFFICRDMVSMEK
*

SD11293.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
RfC3-PA 332 CG5313-PA 1..332 19..350 1670 100 Plus
CG8142-PA 353 CG8142-PA 31..303 30..291 533 40.1 Plus
RfC4-PA 331 CG14999-PA 16..329 29..344 486 34.4 Plus
RfC38-PB 356 CG6258-PB 4..339 31..339 267 25.9 Plus
RfC38-PA 356 CG6258-PA 4..339 31..339 267 25.9 Plus

SD11293.pep Sequence

Translation from 54 to 1052

> SD11293.pep
MSETSGPAVRMPWVEKYRPSGLDDLISHEEIISTITRFISRKQLPHLLFY
GPPGTGKTSTILACARQLYSPQQFKSMVLELNASDDRGIGIVRGQILNFA
STRTIFCDTFKLIILDEADAMTNDAQNALRRIIEKYTDNVRFCVICNYLS
KIIPALQSRCTRFRFAPLSQDQMMPRLEKIIEAEAVQITEDGKRALLTLA
KGDMRKVLNVLQSTVMAFDTVNEDNVYMCVGYPLRQDIEQILKALLSGSS
LEDSFKTVESAKYARGLALEDIITELHLFVMRLELPMSVMNKLIVKLAQI
EERLAKGCTEVAQTAALVAAFFICRDMVSMEK*

SD11293.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15785-PA 332 GF15785-PA 1..332 1..332 1703 95.8 Plus
Dana\GF21175-PA 352 GF21175-PA 31..339 13..313 535 37.7 Plus
Dana\GF23886-PA 331 GF23886-PA 15..322 10..319 503 34.7 Plus
Dana\GF14225-PA 356 GF14225-PA 4..236 13..217 275 30.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:29:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10129-PA 332 GG10129-PA 1..332 1..332 1763 99.4 Plus
Dere\GG18160-PA 353 GG18160-PA 22..340 7..313 553 38.7 Plus
Dere\GG14218-PA 331 GG14218-PA 15..326 10..323 504 34.6 Plus
Dere\GG10322-PA 356 GG10322-PA 4..236 13..217 277 31.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13305-PA 332 GH13305-PA 1..331 1..331 1501 82.2 Plus
Dgri\GH18198-PA 356 GH18198-PA 34..343 12..313 559 39.2 Plus
Dgri\GH15919-PA 331 GH15919-PA 16..326 11..323 502 36.5 Plus
Dgri\GH10966-PA 356 GH10966-PA 4..339 13..321 279 28 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:53
Subject Length Description Subject Range Query Range Score Percent Strand
RfC3-PA 332 CG5313-PA 1..332 1..332 1670 100 Plus
CG8142-PA 353 CG8142-PA 31..303 12..273 533 40.1 Plus
RfC4-PA 331 CG14999-PA 16..329 11..326 486 34.4 Plus
RfC38-PB 356 CG6258-PB 4..339 13..321 267 25.9 Plus
RfC38-PA 356 CG6258-PA 4..339 13..321 267 25.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18168-PA 332 GI18168-PA 1..331 1..331 1512 83.1 Plus
Dmoj\GI10150-PA 354 GI10150-PA 32..341 12..313 548 38.3 Plus
Dmoj\GI16571-PA 331 GI16571-PA 1..322 1..319 512 35.9 Plus
Dmoj\GI18150-PA 356 GI18150-PA 4..339 13..321 276 27.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19009-PA 333 GL19009-PA 1..332 1..332 1494 82.5 Plus
Dper\GL14564-PA 354 GL14564-PA 32..341 12..313 559 38.2 Plus
Dper\GL12737-PA 331 GL12737-PA 15..288 10..285 482 36.1 Plus
Dper\GL18586-PA 356 GL18586-PA 4..236 13..217 278 31.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25212-PA 333 GA25212-PA 1..332 1..332 1497 82.8 Plus
Dpse\GA20846-PA 354 GA20846-PA 32..341 12..313 564 38.5 Plus
Dpse\GA13416-PA 331 GA13416-PA 15..288 10..285 482 36.1 Plus
Dpse\GA19473-PA 356 GA19473-PA 4..236 13..217 278 31.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18361-PA 332 GM18361-PA 1..332 1..332 1770 100 Plus
Dsec\GM14011-PA 331 GM14011-PA 15..326 10..323 504 34.6 Plus
Dsec\GM22851-PA 326 GM22851-PA 20..210 5..185 489 49 Plus
Dsec\GM11127-PA 351 GM11127-PA 4..236 13..217 270 30.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 04:29:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23698-PA 332 GD23698-PA 1..332 1..332 1770 100 Plus
Dsim\GD13291-PA 331 GD13291-PA 15..326 10..323 504 34.6 Plus
Dsim\GD22189-PA 227 GD22189-PA 4..217 13..198 259 31.9 Plus
Dsim\GD15662-PA 208 GD15662-PA 1..158 121..273 244 33.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:29:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14606-PA 332 GJ14606-PA 1..331 1..331 1516 83.4 Plus
Dvir\GJ23369-PA 356 GJ23369-PA 22..343 4..313 565 38.4 Plus
Dvir\GJ12823-PA 331 GJ12823-PA 16..322 11..319 508 36.9 Plus
Dvir\GJ14536-PA 356 GJ14536-PA 4..339 13..321 278 27.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15259-PA 331 GK15259-PA 4..331 5..332 1551 86.3 Plus
Dwil\GK25619-PA 355 GK25619-PA 20..342 4..313 553 38.2 Plus
Dwil\GK10084-PA 333 GK10084-PA 18..324 11..319 511 35.8 Plus
Dwil\GK15241-PA 356 GK15241-PA 4..263 13..242 279 30.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18941-PA 332 GE18941-PA 1..332 1..332 1755 98.8 Plus
Dyak\GE15569-PA 353 GE15569-PA 31..340 12..313 551 38.9 Plus
Dyak\GE20646-PA 331 GE20646-PA 15..326 10..323 505 34.6 Plus
Dyak\GE12972-PA 356 GE12972-PA 4..236 13..217 271 30.2 Plus