BDGP Sequence Production Resources |
Search the DGRC for SD11986
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 119 |
Well: | 86 |
Vector: | pOT2 |
Associated Gene/Transcript | CG18619-RC |
Protein status: | SD11986.pep: gold |
Sequenced Size: | 527 |
Gene | Date | Evidence |
---|---|---|
CG18619 | 2002-01-01 | Sim4 clustering to Release 2 |
CG18619-RC | 2009-10-15 | EST screening |
527 bp assembled on 2009-10-29
GenBank Submission: BT100179.1
> SD11986.complete TTACCTTGAGTATTTACGAAAGACGCATAATAACAAAGAGTTGCAAAGTT GTTGTATTATTTGAGAGTTATAATGGCTGATATGGAGATACAGAGCAACA AAATGTCAATAACGGAGGAAACACAAGTGACGCGCAAGGAATGTGGAAAA AGGGGACGAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGACATGAA AGCCAAACTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGCGCGCA AGAAGCTGCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGGAGAAG GCTGTAGTTGCTTTGCGTACGGAACTGGAGCGCGTCGTTAATTCAATGGA ATAACCAGTTGAGCGAAAGCAACACTCCAACCAACAATGACCAGTTACTT CAGGAACTCGGAATCCTCAAACAAGAATAACCTACATTCTTATTTTTAGC TTAAGAATATTACTTTTATAATAAATGTACGACGGTTACTATTTATATTA TTACGAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 10263802..10263970 | 337..505 | 845 | 100 | Plus |
chr2L | 23010047 | chr2L | 10262992..10263120 | 1..129 | 645 | 100 | Plus |
chr2L | 23010047 | chr2L | 10263618..10263745 | 210..337 | 640 | 100 | Plus |
chr2L | 23010047 | chr2L | 10263407..10263489 | 129..211 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10264946..10265118 | 337..509 | 865 | 100 | Plus |
2L | 23513712 | 2L | 10264136..10264264 | 1..129 | 645 | 100 | Plus |
2L | 23513712 | 2L | 10264762..10264889 | 210..337 | 640 | 100 | Plus |
2L | 23513712 | 2L | 10264551..10264633 | 129..211 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10264946..10265118 | 337..509 | 865 | 100 | Plus |
2L | 23513712 | 2L | 10264136..10264264 | 1..129 | 645 | 100 | Plus |
2L | 23513712 | 2L | 10264762..10264889 | 210..337 | 640 | 100 | Plus |
2L | 23513712 | 2L | 10264551..10264633 | 129..211 | 415 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Burdock | 6411 | Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). | 5561..5615 | 500..445 | 106 | 67.9 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10262992..10263120 | 1..129 | 100 | -> | Plus |
chr2L | 10263408..10263489 | 130..211 | 100 | -> | Plus |
chr2L | 10263620..10263745 | 212..337 | 100 | -> | Plus |
chr2L | 10263803..10263970 | 338..505 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 73..430 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 73..430 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 73..430 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RB | 1..354 | 73..430 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RC | 6..510 | 1..505 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RC | 6..510 | 1..505 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RC | 12..516 | 1..505 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG18619-RC | 12..516 | 1..505 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264764..10264889 | 212..337 | 100 | -> | Plus |
2L | 10264552..10264633 | 130..211 | 100 | -> | Plus |
2L | 10264947..10265114 | 338..505 | 100 | Plus | |
2L | 10264136..10264264 | 1..129 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264764..10264889 | 212..337 | 100 | -> | Plus |
2L | 10264552..10264633 | 130..211 | 100 | -> | Plus |
2L | 10264947..10265114 | 338..505 | 100 | Plus | |
2L | 10264136..10264264 | 1..129 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264764..10264889 | 212..337 | 100 | -> | Plus |
2L | 10264552..10264633 | 130..211 | 100 | -> | Plus |
2L | 10264947..10265114 | 338..505 | 100 | Plus | |
2L | 10264136..10264264 | 1..129 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10264136..10264264 | 1..129 | 100 | -> | Plus |
arm_2L | 10264552..10264633 | 130..211 | 100 | -> | Plus |
arm_2L | 10264764..10264889 | 212..337 | 100 | -> | Plus |
arm_2L | 10264947..10265114 | 338..505 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10264136..10264264 | 1..129 | 100 | -> | Plus |
2L | 10264552..10264633 | 130..211 | 100 | -> | Plus |
2L | 10264764..10264889 | 212..337 | 100 | -> | Plus |
2L | 10264947..10265114 | 338..505 | 100 | Plus |
Translation from 72 to 353
> SD11986.hyp MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR QSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG18619-PC | 93 | CG18619-PC | 1..93 | 1..93 | 459 | 100 | Plus |
CG18619-PD | 94 | CG18619-PD | 1..94 | 1..93 | 447 | 98.9 | Plus |
CG18619-PB | 117 | CG18619-PB | 1..89 | 1..89 | 435 | 97.8 | Plus |
CG18619-PA | 118 | CG18619-PA | 1..90 | 1..89 | 423 | 96.7 | Plus |
Translation from 72 to 353
> SD11986.pep MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR QSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15758-PA | 93 | GF15758-PA | 1..93 | 1..93 | 422 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10098-PA | 117 | GG10098-PA | 1..89 | 1..89 | 439 | 96.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH13018-PA | 118 | GH13018-PA | 1..87 | 4..89 | 341 | 79.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
REPTOR-BP-PC | 93 | CG18619-PC | 1..93 | 1..93 | 459 | 100 | Plus |
REPTOR-BP-PD | 94 | CG18619-PD | 1..94 | 1..93 | 447 | 98.9 | Plus |
REPTOR-BP-PB | 117 | CG18619-PB | 1..89 | 1..89 | 435 | 97.8 | Plus |
REPTOR-BP-PA | 118 | CG18619-PA | 1..90 | 1..89 | 423 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18265-PA | 118 | GI18265-PA | 1..88 | 4..90 | 341 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19008-PA | 115 | GL19008-PA | 1..87 | 4..89 | 360 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA15016-PA | 108 | GA15016-PA | 1..80 | 11..89 | 335 | 85 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18070-PA | 94 | GM18070-PA | 1..94 | 1..93 | 441 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23670-PA | 94 | GD23670-PA | 1..94 | 1..93 | 441 | 95.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17525-PA | 118 | GJ17525-PA | 1..88 | 4..90 | 343 | 78.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23539-PA | 111 | GK23539-PA | 1..80 | 11..89 | 330 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18912-PA | 117 | GE18912-PA | 1..89 | 1..89 | 434 | 95.5 | Plus |