Clone SD11986 Report

Search the DGRC for SD11986

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:119
Well:86
Vector:pOT2
Associated Gene/TranscriptCG18619-RC
Protein status:SD11986.pep: gold
Sequenced Size:527

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18619 2002-01-01 Sim4 clustering to Release 2
CG18619-RC 2009-10-15 EST screening

Clone Sequence Records

SD11986.complete Sequence

527 bp assembled on 2009-10-29

GenBank Submission: BT100179.1

> SD11986.complete
TTACCTTGAGTATTTACGAAAGACGCATAATAACAAAGAGTTGCAAAGTT
GTTGTATTATTTGAGAGTTATAATGGCTGATATGGAGATACAGAGCAACA
AAATGTCAATAACGGAGGAAACACAAGTGACGCGCAAGGAATGTGGAAAA
AGGGGACGAAAACCAGGAAGAAAGACGTCTACTGAAAAATTGGACATGAA
AGCCAAACTAGAACGCAGCAGACAAAGTGCCAGGGAATGCCGGGCGCGCA
AGAAGCTGCGGTATCAGTACCTGGAGGAACTGGTGGCGGATCGGGAGAAG
GCTGTAGTTGCTTTGCGTACGGAACTGGAGCGCGTCGTTAATTCAATGGA
ATAACCAGTTGAGCGAAAGCAACACTCCAACCAACAATGACCAGTTACTT
CAGGAACTCGGAATCCTCAAACAAGAATAACCTACATTCTTATTTTTAGC
TTAAGAATATTACTTTTATAATAAATGTACGACGGTTACTATTTATATTA
TTACGAAAAAAAAAAAAAAAAAAAAAA

SD11986.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-RC 713 CG18619-RC 56..564 1..509 2545 100 Plus
CG18619-RD 658 CG18619-RD 36..547 1..509 2490 99.4 Plus
CG18619-RB 671 CG18619-RB 56..560 1..509 2460 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10263802..10263970 337..505 845 100 Plus
chr2L 23010047 chr2L 10262992..10263120 1..129 645 100 Plus
chr2L 23010047 chr2L 10263618..10263745 210..337 640 100 Plus
chr2L 23010047 chr2L 10263407..10263489 129..211 415 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:54:54 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264946..10265118 337..509 865 100 Plus
2L 23513712 2L 10264136..10264264 1..129 645 100 Plus
2L 23513712 2L 10264762..10264889 210..337 640 100 Plus
2L 23513712 2L 10264551..10264633 129..211 415 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10264946..10265118 337..509 865 100 Plus
2L 23513712 2L 10264136..10264264 1..129 645 100 Plus
2L 23513712 2L 10264762..10264889 210..337 640 100 Plus
2L 23513712 2L 10264551..10264633 129..211 415 100 Plus
Blast to na_te.dros performed 2019-03-16 01:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Burdock 6411 Burdock DMU89994 6411bp Derived from U89994 (g1905850) (Rel. 51, Last updated, Version 1). 5561..5615 500..445 106 67.9 Minus

SD11986.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:54:53 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10262992..10263120 1..129 100 -> Plus
chr2L 10263408..10263489 130..211 100 -> Plus
chr2L 10263620..10263745 212..337 100 -> Plus
chr2L 10263803..10263970 338..505 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-29 11:34:34 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 73..430 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:14:34 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 73..430 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:05 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 73..430 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:50:37 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RB 1..354 73..430 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-29 11:34:33 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RC 6..510 1..505 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:14:34 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RC 6..510 1..505 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:05 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RC 12..516 1..505 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:50:37 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
CG18619-RC 12..516 1..505 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:53 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264764..10264889 212..337 100 -> Plus
2L 10264552..10264633 130..211 100 -> Plus
2L 10264947..10265114 338..505 100   Plus
2L 10264136..10264264 1..129 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:53 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264764..10264889 212..337 100 -> Plus
2L 10264552..10264633 130..211 100 -> Plus
2L 10264947..10265114 338..505 100   Plus
2L 10264136..10264264 1..129 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:54:53 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264764..10264889 212..337 100 -> Plus
2L 10264552..10264633 130..211 100 -> Plus
2L 10264947..10265114 338..505 100   Plus
2L 10264136..10264264 1..129 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:05 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10264136..10264264 1..129 100 -> Plus
arm_2L 10264552..10264633 130..211 100 -> Plus
arm_2L 10264764..10264889 212..337 100 -> Plus
arm_2L 10264947..10265114 338..505 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:04:53 Download gff for SD11986.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10264136..10264264 1..129 100 -> Plus
2L 10264552..10264633 130..211 100 -> Plus
2L 10264764..10264889 212..337 100 -> Plus
2L 10264947..10265114 338..505 100   Plus

SD11986.hyp Sequence

Translation from 72 to 353

> SD11986.hyp
MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR
QSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*

SD11986.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:21:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG18619-PC 93 CG18619-PC 1..93 1..93 459 100 Plus
CG18619-PD 94 CG18619-PD 1..94 1..93 447 98.9 Plus
CG18619-PB 117 CG18619-PB 1..89 1..89 435 97.8 Plus
CG18619-PA 118 CG18619-PA 1..90 1..89 423 96.7 Plus

SD11986.pep Sequence

Translation from 72 to 353

> SD11986.pep
MADMEIQSNKMSITEETQVTRKECGKRGRKPGRKTSTEKLDMKAKLERSR
QSARECRARKKLRYQYLEELVADREKAVVALRTELERVVNSME*

SD11986.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 19:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15758-PA 93 GF15758-PA 1..93 1..93 422 90.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 19:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10098-PA 117 GG10098-PA 1..89 1..89 439 96.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 19:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13018-PA 118 GH13018-PA 1..87 4..89 341 79.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:01
Subject Length Description Subject Range Query Range Score Percent Strand
REPTOR-BP-PC 93 CG18619-PC 1..93 1..93 459 100 Plus
REPTOR-BP-PD 94 CG18619-PD 1..94 1..93 447 98.9 Plus
REPTOR-BP-PB 117 CG18619-PB 1..89 1..89 435 97.8 Plus
REPTOR-BP-PA 118 CG18619-PA 1..90 1..89 423 96.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 19:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18265-PA 118 GI18265-PA 1..88 4..90 341 78.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 19:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19008-PA 115 GL19008-PA 1..87 4..89 360 83.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 19:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15016-PA 108 GA15016-PA 1..80 11..89 335 85 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 19:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18070-PA 94 GM18070-PA 1..94 1..93 441 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 19:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23670-PA 94 GD23670-PA 1..94 1..93 441 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 19:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17525-PA 118 GJ17525-PA 1..88 4..90 343 78.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 19:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23539-PA 111 GK23539-PA 1..80 11..89 330 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 19:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18912-PA 117 GE18912-PA 1..89 1..89 434 95.5 Plus