Clone SD12355 Report

Search the DGRC for SD12355

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:123
Well:55
Vector:pOT2
Associated Gene/TranscriptCSN8-RB
Protein status:SD12355.pep: gold
Sequenced Size:649

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CSN8 2008-04-29 Release 5.5 accounting
CSN8 2008-08-15 Release 5.9 accounting
CSN8 2008-12-18 5.12 accounting

Clone Sequence Records

SD12355.complete Sequence

649 bp (649 high quality bases) assembled on 2004-01-31

GenBank Submission: BT011518

> SD12355.complete
TTGCAGCACGCTAAACGGTCACATTATTGTTTCCCGACCAAGAATTTACC
AATAAAATGCATTTAAATAAATATAGTGAAGTAGTGGAGCGGCTTGAGAA
CGAGGAATTTGAGCAAGTCGAACTGGGAGCTGAAGTCTACCAGCAATTAC
TTGCTATTTACCTCTATCAAAACAAACTGGCTGATGCCAAGTTGTTGTGG
ATGAGAGTTCCAGCTAACCTAAGGGATGACAAGGAACTGATCCAGCTGAA
CCTGCTCAATATTGCCCTGCAGAACAATAACTATGCCGATTTCTTCAAAC
ACATCAAGTATGAGTGGTCGGAAAGAGTAAAGTCACCTGTGGAGGATCTT
CTAAATAAGCAACGCGAAGAGCTGTTCAAACTAATGGGCAGCGCATATAT
GTCCATTTACCAGCACAATCTACTGGAATTGTCACTAATGTCGGAGGACG
AACTGAAACACGCCTGTGCGGCCTTAAATTGGACTGAGGAACTGGACGGT
GACCGGGTAATCCTGAAGCCCAAGGTTCAGGAAGCACCGCCAGCTCGTGG
AAACGATGACCAGTTGCTTAAGTTGACCGAGTTTGTAACCTTCCTAGAGA
ATTAAGCCTCAATAAATTTCAATACATTTAAAAAAAAAAAAAAAAAAAA

SD12355.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:04:53
Subject Length Description Subject Range Query Range Score Percent Strand
CSN8-RB 844 CSN8-RB 92..722 1..631 3155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:59:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8364305..8364579 355..629 1375 100 Plus
chr2L 23010047 chr2L 8364069..8364244 179..354 880 100 Plus
chr2L 23010047 chr2L 8363783..8363895 1..113 565 100 Plus
chr2L 23010047 chr2L 8363954..8364021 112..179 340 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8365389..8365665 355..631 1385 100 Plus
2L 23513712 2L 8365153..8365328 179..354 880 100 Plus
2L 23513712 2L 8364867..8364979 1..113 565 100 Plus
2L 23513712 2L 8365038..8365105 112..179 340 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8365389..8365665 355..631 1385 100 Plus
2L 23513712 2L 8365153..8365328 179..354 880 100 Plus
2L 23513712 2L 8364867..8364979 1..113 565 100 Plus
2L 23513712 2L 8365038..8365105 112..179 340 100 Plus
Blast to na_te.dros performed 2019-03-16 20:59:24
Subject Length Description Subject Range Query Range Score Percent Strand
F-element 4708 F-element F 4708bp 2581..2611 156..186 119 87.1 Plus

SD12355.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:00:33 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8363783..8363895 1..113 100 -> Plus
chr2L 8363956..8364020 114..178 100 -> Plus
chr2L 8364069..8364244 179..354 100 -> Plus
chr2L 8364305..8364579 355..629 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:07:27 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 1..549 57..605 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:40:23 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 1..549 57..605 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:55 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 1..549 57..605 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:29:15 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 1..549 57..605 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:02:20 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 1..549 57..605 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:49:20 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 1..629 1..629 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:40:23 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 36..664 1..629 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:55 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 13..641 1..629 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:29:15 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 1..629 1..629 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:20 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
CSN8-RB 13..641 1..629 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:33 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8364867..8364979 1..113 100 -> Plus
2L 8365040..8365104 114..178 100 -> Plus
2L 8365153..8365328 179..354 100 -> Plus
2L 8365389..8365663 355..629 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:33 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8364867..8364979 1..113 100 -> Plus
2L 8365040..8365104 114..178 100 -> Plus
2L 8365153..8365328 179..354 100 -> Plus
2L 8365389..8365663 355..629 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:00:33 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8364867..8364979 1..113 100 -> Plus
2L 8365040..8365104 114..178 100 -> Plus
2L 8365153..8365328 179..354 100 -> Plus
2L 8365389..8365663 355..629 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:55 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8365040..8365104 114..178 100 -> Plus
arm_2L 8365153..8365328 179..354 100 -> Plus
arm_2L 8365389..8365663 355..629 100   Plus
arm_2L 8364867..8364979 1..113 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:01:37 Download gff for SD12355.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8365389..8365663 355..629 100   Plus
2L 8364867..8364979 1..113 100 -> Plus
2L 8365040..8365104 114..178 100 -> Plus
2L 8365153..8365328 179..354 100 -> Plus

SD12355.pep Sequence

Translation from 56 to 604

> SD12355.pep
MHLNKYSEVVERLENEEFEQVELGAEVYQQLLAIYLYQNKLADAKLLWMR
VPANLRDDKELIQLNLLNIALQNNNYADFFKHIKYEWSERVKSPVEDLLN
KQREELFKLMGSAYMSIYQHNLLELSLMSEDELKHACAALNWTEELDGDR
VILKPKVQEAPPARGNDDQLLKLTEFVTFLEN*

SD12355.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15220-PA 182 GF15220-PA 1..182 1..182 694 79.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:44:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10539-PA 182 GG10539-PA 1..182 1..182 878 92.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10836-PA 181 GH10836-PA 1..181 1..182 517 62.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:40
Subject Length Description Subject Range Query Range Score Percent Strand
CSN8-PB 182 CG13383-PB 1..182 1..182 937 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:44:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17351-PA 181 GI17351-PA 1..181 1..182 515 61.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19225-PA 182 GL19225-PA 1..182 1..182 674 70.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:44:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25879-PA 182 GA25879-PA 1..182 1..182 666 70.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16907-PA 182 GM16907-PA 1..182 1..182 919 96.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:44:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23529-PA 182 GD23529-PA 1..182 1..182 918 96.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16140-PA 181 GJ16140-PA 1..181 1..182 533 63.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:44:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24158-PA 183 GK24158-PA 1..183 1..182 549 63.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:44:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18760-PA 182 GE18760-PA 1..182 1..182 896 94 Plus

SD12355.hyp Sequence

Translation from 56 to 604

> SD12355.hyp
MHLNKYSEVVERLENEEFEQVELGAEVYQQLLAIYLYQNKLADAKLLWMR
VPANLRDDKELIQLNLLNIALQNNNYADFFKHIKYEWSERVKSPVEDLLN
KQREELFKLMGSAYMSIYQHNLLELSLMSEDELKHACAALNWTEELDGDR
VILKPKVQEAPPARGNDDQLLKLTEFVTFLEN*

SD12355.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CSN8-PB 182 CG13383-PB 1..182 1..182 937 100 Plus