BDGP Sequence Production Resources |
Search the DGRC for SD12355
Library: | SD |
Tissue Source: | Drosophila melanogaster Schneider L2 cell culture |
Created by: | Ling Hong |
Date Registered: | 1999-02-25 |
Comments: | Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library. |
Original Plate Number: | 123 |
Well: | 55 |
Vector: | pOT2 |
Associated Gene/Transcript | CSN8-RB |
Protein status: | SD12355.pep: gold |
Sequenced Size: | 649 |
Gene | Date | Evidence |
---|---|---|
CSN8 | 2008-04-29 | Release 5.5 accounting |
CSN8 | 2008-08-15 | Release 5.9 accounting |
CSN8 | 2008-12-18 | 5.12 accounting |
649 bp (649 high quality bases) assembled on 2004-01-31
GenBank Submission: BT011518
> SD12355.complete TTGCAGCACGCTAAACGGTCACATTATTGTTTCCCGACCAAGAATTTACC AATAAAATGCATTTAAATAAATATAGTGAAGTAGTGGAGCGGCTTGAGAA CGAGGAATTTGAGCAAGTCGAACTGGGAGCTGAAGTCTACCAGCAATTAC TTGCTATTTACCTCTATCAAAACAAACTGGCTGATGCCAAGTTGTTGTGG ATGAGAGTTCCAGCTAACCTAAGGGATGACAAGGAACTGATCCAGCTGAA CCTGCTCAATATTGCCCTGCAGAACAATAACTATGCCGATTTCTTCAAAC ACATCAAGTATGAGTGGTCGGAAAGAGTAAAGTCACCTGTGGAGGATCTT CTAAATAAGCAACGCGAAGAGCTGTTCAAACTAATGGGCAGCGCATATAT GTCCATTTACCAGCACAATCTACTGGAATTGTCACTAATGTCGGAGGACG AACTGAAACACGCCTGTGCGGCCTTAAATTGGACTGAGGAACTGGACGGT GACCGGGTAATCCTGAAGCCCAAGGTTCAGGAAGCACCGCCAGCTCGTGG AAACGATGACCAGTTGCTTAAGTTGACCGAGTTTGTAACCTTCCTAGAGA ATTAAGCCTCAATAAATTTCAATACATTTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CSN8-RB | 844 | CSN8-RB | 92..722 | 1..631 | 3155 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 8364305..8364579 | 355..629 | 1375 | 100 | Plus |
chr2L | 23010047 | chr2L | 8364069..8364244 | 179..354 | 880 | 100 | Plus |
chr2L | 23010047 | chr2L | 8363783..8363895 | 1..113 | 565 | 100 | Plus |
chr2L | 23010047 | chr2L | 8363954..8364021 | 112..179 | 340 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8365389..8365665 | 355..631 | 1385 | 100 | Plus |
2L | 23513712 | 2L | 8365153..8365328 | 179..354 | 880 | 100 | Plus |
2L | 23513712 | 2L | 8364867..8364979 | 1..113 | 565 | 100 | Plus |
2L | 23513712 | 2L | 8365038..8365105 | 112..179 | 340 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8365389..8365665 | 355..631 | 1385 | 100 | Plus |
2L | 23513712 | 2L | 8365153..8365328 | 179..354 | 880 | 100 | Plus |
2L | 23513712 | 2L | 8364867..8364979 | 1..113 | 565 | 100 | Plus |
2L | 23513712 | 2L | 8365038..8365105 | 112..179 | 340 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
F-element | 4708 | F-element F 4708bp | 2581..2611 | 156..186 | 119 | 87.1 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8363783..8363895 | 1..113 | 100 | -> | Plus |
chr2L | 8363956..8364020 | 114..178 | 100 | -> | Plus |
chr2L | 8364069..8364244 | 179..354 | 100 | -> | Plus |
chr2L | 8364305..8364579 | 355..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 1..549 | 57..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 1..549 | 57..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 1..549 | 57..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 1..549 | 57..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 1..549 | 57..605 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 1..629 | 1..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 36..664 | 1..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 13..641 | 1..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 1..629 | 1..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CSN8-RB | 13..641 | 1..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8364867..8364979 | 1..113 | 100 | -> | Plus |
2L | 8365040..8365104 | 114..178 | 100 | -> | Plus |
2L | 8365153..8365328 | 179..354 | 100 | -> | Plus |
2L | 8365389..8365663 | 355..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8364867..8364979 | 1..113 | 100 | -> | Plus |
2L | 8365040..8365104 | 114..178 | 100 | -> | Plus |
2L | 8365153..8365328 | 179..354 | 100 | -> | Plus |
2L | 8365389..8365663 | 355..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8364867..8364979 | 1..113 | 100 | -> | Plus |
2L | 8365040..8365104 | 114..178 | 100 | -> | Plus |
2L | 8365153..8365328 | 179..354 | 100 | -> | Plus |
2L | 8365389..8365663 | 355..629 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8365040..8365104 | 114..178 | 100 | -> | Plus |
arm_2L | 8365153..8365328 | 179..354 | 100 | -> | Plus |
arm_2L | 8365389..8365663 | 355..629 | 100 | Plus | |
arm_2L | 8364867..8364979 | 1..113 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8365389..8365663 | 355..629 | 100 | Plus | |
2L | 8364867..8364979 | 1..113 | 100 | -> | Plus |
2L | 8365040..8365104 | 114..178 | 100 | -> | Plus |
2L | 8365153..8365328 | 179..354 | 100 | -> | Plus |
Translation from 56 to 604
> SD12355.pep MHLNKYSEVVERLENEEFEQVELGAEVYQQLLAIYLYQNKLADAKLLWMR VPANLRDDKELIQLNLLNIALQNNNYADFFKHIKYEWSERVKSPVEDLLN KQREELFKLMGSAYMSIYQHNLLELSLMSEDELKHACAALNWTEELDGDR VILKPKVQEAPPARGNDDQLLKLTEFVTFLEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15220-PA | 182 | GF15220-PA | 1..182 | 1..182 | 694 | 79.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10539-PA | 182 | GG10539-PA | 1..182 | 1..182 | 878 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10836-PA | 181 | GH10836-PA | 1..181 | 1..182 | 517 | 62.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CSN8-PB | 182 | CG13383-PB | 1..182 | 1..182 | 937 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17351-PA | 181 | GI17351-PA | 1..181 | 1..182 | 515 | 61.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19225-PA | 182 | GL19225-PA | 1..182 | 1..182 | 674 | 70.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25879-PA | 182 | GA25879-PA | 1..182 | 1..182 | 666 | 70.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16907-PA | 182 | GM16907-PA | 1..182 | 1..182 | 919 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23529-PA | 182 | GD23529-PA | 1..182 | 1..182 | 918 | 96.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ16140-PA | 181 | GJ16140-PA | 1..181 | 1..182 | 533 | 63.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24158-PA | 183 | GK24158-PA | 1..183 | 1..182 | 549 | 63.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18760-PA | 182 | GE18760-PA | 1..182 | 1..182 | 896 | 94 | Plus |
Translation from 56 to 604
> SD12355.hyp MHLNKYSEVVERLENEEFEQVELGAEVYQQLLAIYLYQNKLADAKLLWMR VPANLRDDKELIQLNLLNIALQNNNYADFFKHIKYEWSERVKSPVEDLLN KQREELFKLMGSAYMSIYQHNLLELSLMSEDELKHACAALNWTEELDGDR VILKPKVQEAPPARGNDDQLLKLTEFVTFLEN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CSN8-PB | 182 | CG13383-PB | 1..182 | 1..182 | 937 | 100 | Plus |