Clone SD12734 Report

Search the DGRC for SD12734

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:127
Well:34
Vector:pOT2
Associated Gene/Transcript14-3-3zeta-RA
Protein status:SD12734.pep: gold
Sequenced Size:970

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
14-3-3zeta-RA 2009-04-14 Manual selection by Sue Celniker

Clone Sequence Records

SD12734.complete Sequence

970 bp assembled on 2009-09-30

GenBank Submission: BT099909.1

> SD12734.complete
TTCGTTGTCGTTTCAGTTTCAGTTAATCGAGAATAAAGCCATTGTTAGCA
ACTTTTGAGGGGCATATCGAACTGTGTGGCGTATTTTATTAGTTTTGTGA
GGTAACCGAAAAAAAAAAAATCAAACAAAATGTCGACAGTCGATAAGGAA
GAGCTGGTCCAGAAGGCTAAACTGGCCGAGCAGTCAGAACGTTACGATGA
TATGGCCCAGGCCATGAAGTCCGTCACAGAGACTGGCGTTGAGCTCTCAA
ATGAGGAAAGAAATCTGCTCTCCGTTGCCTACAAAAATGTGGTCGGTGCC
CGCAGGTCATCGTGGCGTGTCATCTCCTCCATTGAGCAGAAAACCGAAGC
ATCCGCTAGAAAACAGCAGCTCGCCCGTGAGTACAGAGAGCGTGTGGAGA
AGGAGCTGAGGGAAATCTGCTACGAAGTTTTGGGACTTCTGGACAAATAC
CTTATTCCAAAAGCCAGCAATCCCGAGAGCAAGGTGTTTTACCTGAAGAT
GAAGGGTGATTACTACAGGTATTTAGCCGAGGTTGCCACAGGAGATGCAC
GCAACACCGTCGTTGATGACTCGAAAAATGCCTATCAGGAGGCGTTCGAT
ATTGCAAAAACCAAAATGCAGCCCACGCATCCCATCCGTTTGGGTCTGGC
CCTTAACTTCTCAGTCTTCTACTATGAGATTTTGAACTCACCAGACAAAG
CTTGCCAATTGGCTAAACAGGCGTTCGATGATGCGATAGCCGAGCTGGAC
ACACTGAACGAGGACTCCTACAAGGACTCGACACTCATCATGCAGCTGTT
GAGGGACAACCTGACTCTCTGGACGTCCGACACCCAAGGCGACGAAGCTG
AGCCACAGGAGGGCGGCGACAACTAACCAAACAACTAAGCAAATGTTTCC
TTTTTGACTATGCAAATATTATTCAGTAATACAAACAAACAAAAACCAGA
AAAAAAAAAAAAAAAAAAAA

SD12734.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3zeta.g 2145 14-3-3zeta.g 154..1119 1..969 4655 98.8 Plus
14-3-3zeta.y 2904 14-3-3zeta.y 154..1119 1..969 4655 98.8 Plus
14-3-3zeta.i 3131 14-3-3zeta.i 154..1119 1..969 4655 98.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:13:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 5995011..5995242 718..949 1160 100 Plus
chr2R 21145070 chr2R 5993839..5994003 557..721 825 100 Plus
chr2R 21145070 chr2R 5991804..5991958 35..191 705 98.1 Plus
chr2R 21145070 chr2R 5992487..5992617 303..433 655 100 Plus
chr2R 21145070 chr2R 5993251..5993375 432..556 625 100 Plus
chr2R 21145070 chr2R 5992265..5992381 191..307 585 100 Plus
chr2R 21145070 chr2R 5993491..5993655 557..721 510 87.3 Plus
chr2R 21145070 chr2R 5994184..5994348 557..721 450 84.8 Plus
chr3R 27901430 chr3R 14072268..14072431 667..830 355 81.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10107464..10107715 718..969 1185 98 Plus
2R 25286936 2R 10106289..10106453 557..721 795 98.8 Plus
2R 25286936 2R 10104256..10104409 35..191 690 97.5 Plus
2R 25286936 2R 10104938..10105068 303..433 655 100 Plus
2R 25286936 2R 10105701..10105825 432..556 625 100 Plus
2R 25286936 2R 10104716..10104832 191..307 585 100 Plus
2R 25286936 2R 10105941..10106105 557..721 525 87.9 Plus
2R 25286936 2R 10106634..10106798 557..721 450 84.8 Plus
3R 32079331 3R 18247974..18248137 667..830 355 81.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10108663..10108914 718..969 1185 98 Plus
2R 25260384 2R 10107488..10107652 557..721 795 98.7 Plus
2R 25260384 2R 10105455..10105608 35..191 700 97.4 Plus
2R 25260384 2R 10106137..10106267 303..433 655 100 Plus
2R 25260384 2R 10106900..10107024 432..556 625 100 Plus
2R 25260384 2R 10105915..10106031 191..307 585 100 Plus
2R 25260384 2R 10107196..10107304 613..721 515 98.1 Plus
2R 25260384 2R 10107833..10107997 557..721 450 84.8 Plus
3R 31820162 3R 17988805..17988968 667..830 355 81 Plus
2R 25260384 2R 10102263..10102296 1..34 170 100 Plus
Blast to na_te.dros performed 2019-03-16 01:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dnet\R1B 2038 Dnet\R1B NETR1B 2038bp 1212..1273 473..412 112 64.5 Minus

SD12734.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:14:37 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 5993839..5994002 557..720 100 -> Plus
chr2R 5988617..5988650 1..34 100 -> Plus
chr2R 5991804..5991958 35..191 98 -> Plus
chr2R 5992266..5992379 192..305 100 -> Plus
chr2R 5992490..5992616 306..432 100 -> Plus
chr2R 5993252..5993375 433..556 100 -> Plus
chr2R 5995014..5995242 721..949 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:24 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RG 1..747 130..876 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:55 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RG 1..747 130..876 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:33 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RG 1..747 130..876 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:27:37 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RG 1..747 130..876 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-30 10:17:00 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RI 33..978 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:55 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RI 33..978 1..949 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:33 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RA 29..974 1..949 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:27:37 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
14-3-3zeta-RA 29..974 1..949 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:37 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10101064..10101097 1..34 100 -> Plus
2R 10104256..10104409 35..191 97 -> Plus
2R 10104717..10104830 192..305 100 -> Plus
2R 10104941..10105067 306..432 100 -> Plus
2R 10105702..10105825 433..556 100 -> Plus
2R 10106289..10106452 557..720 98 -> Plus
2R 10107467..10107695 721..949 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:37 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10101064..10101097 1..34 100 -> Plus
2R 10104256..10104409 35..191 97 -> Plus
2R 10104717..10104830 192..305 100 -> Plus
2R 10104941..10105067 306..432 100 -> Plus
2R 10105702..10105825 433..556 100 -> Plus
2R 10106289..10106452 557..720 98 -> Plus
2R 10107467..10107695 721..949 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:14:37 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10101064..10101097 1..34 100 -> Plus
2R 10104256..10104409 35..191 97 -> Plus
2R 10104717..10104830 192..305 100 -> Plus
2R 10104941..10105067 306..432 100 -> Plus
2R 10105702..10105825 433..556 100 -> Plus
2R 10106289..10106452 557..720 98 -> Plus
2R 10107467..10107695 721..949 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:33 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 5993794..5993957 557..720 98 -> Plus
arm_2R 5988569..5988602 1..34 100 -> Plus
arm_2R 5991761..5991914 35..191 97 -> Plus
arm_2R 5992222..5992335 192..305 100 -> Plus
arm_2R 5992446..5992572 306..432 100 -> Plus
arm_2R 5993207..5993330 433..556 100 -> Plus
arm_2R 5994972..5995200 721..949 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:21 Download gff for SD12734.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10108666..10108894 721..949 100   Plus
2R 10102263..10102296 1..34 100 -> Plus
2R 10105455..10105608 35..191 97 -> Plus
2R 10105916..10106029 192..305 100 -> Plus
2R 10106140..10106266 306..432 100 -> Plus
2R 10106901..10107024 433..556 100 -> Plus
2R 10107488..10107651 557..720 98 -> Plus

SD12734.pep Sequence

Translation from 129 to 875

> SD12734.pep
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN*

SD12734.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 13:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12019-PA 248 GF12019-PA 1..248 1..248 1274 97.2 Plus
Dana\GF23073-PA 263 GF23073-PA 2..245 4..245 858 67.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:58:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24140-PA 248 GG24140-PA 1..248 1..248 1288 98 Plus
Dere\GG22781-PA 262 GG22781-PA 3..245 5..245 853 67.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 13:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21250-PA 248 GH21250-PA 1..248 1..248 1274 97.2 Plus
Dgri\GH18560-PA 260 GH18560-PA 2..245 4..245 845 66.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:43
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3zeta-PI 248 CG17870-PI 1..248 1..248 1255 100 Plus
14-3-3zeta-PA 248 CG17870-PA 1..248 1..248 1255 100 Plus
14-3-3zeta-PG 248 CG17870-PG 1..248 1..248 1255 100 Plus
14-3-3zeta-PH 248 CG17870-PH 1..248 1..248 1255 100 Plus
14-3-3zeta-PB 248 CG17870-PB 1..248 1..248 1255 100 Plus
14-3-3zeta-PL 248 CG17870-PL 1..248 1..248 1232 98 Plus
14-3-3zeta-PK 248 CG17870-PK 1..248 1..248 1232 98 Plus
14-3-3zeta-PJ 248 CG17870-PJ 1..248 1..248 1232 98 Plus
14-3-3zeta-PE 248 CG17870-PE 1..248 1..248 1232 98 Plus
14-3-3zeta-PD 248 CG17870-PD 1..248 1..248 1232 98 Plus
14-3-3zeta-PC 248 CG17870-PC 1..248 1..248 1227 97.6 Plus
14-3-3zeta-PF 248 CG17870-PF 1..248 1..248 1227 97.6 Plus
14-3-3epsilon-PA 262 CG31196-PA 3..245 5..245 829 67.1 Plus
14-3-3epsilon-PC 256 CG31196-PC 3..245 5..244 818 67.1 Plus
14-3-3epsilon-PD 260 CG31196-PD 3..245 5..245 816 66.3 Plus
14-3-3epsilon-PB 261 CG31196-PB 3..244 5..245 815 67.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 13:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20537-PA 248 GI20537-PA 1..248 1..248 1274 97.2 Plus
Dmoj\GI24759-PA 260 GI24759-PA 2..245 4..245 845 66.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17609-PA 248 GL17609-PA 1..248 1..248 1274 97.2 Plus
Dper\GL21790-PA 262 GL21790-PA 3..245 5..245 853 67.1 Plus
Dper\GL25387-PA 250 GL25387-PA 10..235 12..236 613 52.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24843-PA 248 GA24843-PA 1..248 1..248 1274 97.2 Plus
Dpse\GA16084-PA 262 GA16084-PA 3..245 5..245 853 67.1 Plus
Dpse\GA22759-PA 250 GA22759-PA 10..235 12..236 608 52.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21186-PA 248 GM21186-PA 1..248 1..248 1288 98 Plus
Dsec\GM15292-PA 262 GM15292-PA 3..245 5..245 853 67.1 Plus
Dsec\GM12998-PA 138 GM12998-PA 55..138 165..248 452 97.6 Plus
Dsec\GM12998-PA 138 GM12998-PA 1..54 1..54 238 90.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12271-PA 248 GD12271-PA 1..248 1..248 1282 97.6 Plus
Dsim\GD15169-PA 240 GD15169-PA 1..223 25..245 793 67.3 Plus
Dsim\GD24394-PA 51 GD24394-PA 2..49 184..231 239 93.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 13:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22386-PA 248 GJ22386-PA 1..248 1..248 1269 96.8 Plus
Dvir\GJ22546-PA 260 GJ22546-PA 2..245 4..245 845 66.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 13:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21486-PA 248 GK21486-PA 1..248 1..248 1274 97.2 Plus
Dwil\GK22388-PA 260 GK22388-PA 2..245 4..245 839 66 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:58:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\14-3-3zeta-PA 248 GE19338-PA 1..248 1..248 1288 98 Plus
Dyak\GE25525-PA 256 GE25525-PA 3..245 5..244 841 67.1 Plus

SD12734.hyp Sequence

Translation from 129 to 875

> SD12734.hyp
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVA
YKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEV
LGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKN
AYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFD
DAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEAEPQEGGDN*

SD12734.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:12
Subject Length Description Subject Range Query Range Score Percent Strand
14-3-3zeta-PI 248 CG17870-PI 1..248 1..248 1255 100 Plus
14-3-3zeta-PA 248 CG17870-PA 1..248 1..248 1255 100 Plus
14-3-3zeta-PG 248 CG17870-PG 1..248 1..248 1255 100 Plus
14-3-3zeta-PH 248 CG17870-PH 1..248 1..248 1255 100 Plus
14-3-3zeta-PB 248 CG17870-PB 1..248 1..248 1255 100 Plus