Clone SD13256 Report

Search the DGRC for SD13256

Clone and Library Details

Library:SD
Tissue Source:Drosophila melanogaster Schneider L2 cell culture
Created by:Ling Hong
Date Registered:1999-02-25
Comments:Sized fractionated cDNAs were directly ligated into pOT2. Plasmid cDNA library.
Original Plate Number:132
Well:56
Vector:pOT2
Associated Gene/TranscriptCG30094-RA
Protein status:SD13256.pep: gold
Sequenced Size:631

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30094 2002-10-31 Blastp of sequenced clone
CG30094 2003-01-01 Sim4 clustering to Release 3
CG30094 2008-04-29 Release 5.5 accounting

Clone Sequence Records

SD13256.complete Sequence

631 bp (631 high quality bases) assembled on 2002-10-31

GenBank Submission: BT001881

> SD13256.complete
ATTTAAGGAAATTAGCAAAACATCATCAATATTAGGCGAATTCGAGAGAT
TTTTCAATGGCAGACGATCCAAACAAACCCTCTACCTCGTCGAAAACTGA
AGATGCTCCCCTGTTCCCGCCCGCAAAACCAGGAAAAAGAGTTGACTATG
GGACAAACAACACATTGGAGCTACTGGAGCGGATTCCCAGCCAGGTGGTG
GATCTAAAGCTGGACGATGTGCTGACAGCCGTCAAGGAAGTGGATAACCT
CTGCGACTATCCGCGCTGCAAAACCAAAACCAGCCTGATGGGCCAAGACT
GCCAGCATTGCAAGAAGAGATTCTGCTTCAAGCACGGACTGCCAGAGGTG
CACGGATGTGGCGAGGAGATTAAGCGGGACGAGCGCAAGAAGTTTCTGCA
CCCAAAGCCGGCGAAAACCATCAGGCAGGAGGAGGATGTGAAGAATGCGA
AAAAGCGTCTGGATGCTAAGTTAAAGGAAATGCAGTTGGGGCGCACTCAA
AAAGCCACCGGAGGAGGTTCCAAAAAGAAGAACGGAAAATAGGAGGGAGT
ATGATTATGTTAGTTTATTAAATCTTTACAAATACAATGTTCTCAAAAGG
TGTTTCAGTACAAAAAAAAAAAAAAAAAAAA

SD13256.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:55:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG30094-RA 814 CG30094-RA 56..667 1..612 2850 97.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12029669..12030220 60..611 2715 99.5 Plus
chr2R 21145070 chr2R 12029551..12029613 1..63 255 93.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 21:55:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:58:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16142350..16142902 60..612 2645 98.6 Plus
2R 25286936 2R 16142232..16142294 1..63 225 90.5 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16143549..16144101 60..612 2645 98.5 Plus
2R 25260384 2R 16143431..16143493 1..63 225 90.4 Plus
Blast to na_te.dros performed on 2019-03-16 23:58:50 has no hits.

SD13256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:59:31 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12029551..12029613 1..63 93 -> Plus
chr2R 12029673..12030220 64..611 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 21:07:38 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..486 57..542 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:28:21 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..486 57..542 98   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:27:23 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..486 57..542 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:12:21 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..486 57..542 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:06:34 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..486 57..542 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:31:53 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..611 1..611 97   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:28:21 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..611 1..611 97   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:27:23 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 31..641 1..611 97   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:12:21 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 1..611 1..611 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:06:34 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
CG30094-RA 31..641 1..611 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:31 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16142354..16142901 64..611 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:31 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16142354..16142901 64..611 98   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:31 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16142354..16142901 64..611 98   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:27:23 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12029859..12030406 64..611 98   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:48:59 Download gff for SD13256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16143553..16144100 64..611 98   Plus

SD13256.pep Sequence

Translation from 56 to 541

> SD13256.pep
MADDPNKPSTSSKTEDAPLFPPAKPGKRVDYGTNNTLELLERIPSQVVDL
KLDDVLTAVKEVDNLCDYPRCKTKTSLMGQDCQHCKKRFCFKHGLPEVHG
CGEEIKRDERKKFLHPKPAKTIRQEEDVKNAKKRLDAKLKEMQLGRTQKA
TGGGSKKKNGK*

SD13256.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11859-PA 161 GF11859-PA 1..151 1..151 725 89.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:31:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20573-PA 161 GG20573-PA 1..161 1..161 837 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21677-PA 154 GH21677-PA 1..142 6..148 532 74.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG30094-PA 161 CG30094-PA 1..161 1..161 862 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:31:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18832-PA 169 GI18832-PA 19..168 9..158 578 76.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:31:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10097-PA 83 GL10097-PA 1..74 78..151 360 91.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25075-PA 160 GA25075-PA 1..151 1..151 728 90.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:31:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21665-PA 161 GM21665-PA 1..161 1..161 838 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11165-PA 161 GD11165-PA 1..161 1..161 830 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:31:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21859-PA 156 GJ21859-PA 1..146 3..148 565 76 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21962-PA 166 GK21962-PA 1..158 1..152 674 81.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:31:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11759-PA 161 GE11759-PA 1..161 1..161 826 97.5 Plus

SD13256.hyp Sequence

Translation from 65 to 541

> SD13256.hyp
DPNKPSTSSKTEDAPLFPPAKPGKRVDYGTNNTLELLERIPSQVVDLKLD
DVLTAVKEVDNLCDYPRCKTKTSLMGQDCQHCKKRFCFKHGLPEVHGCGE
EIKRDERKKFLHPKPAKTIRQEEDVKNAKKRLDAKLKEMQLGRTQKATGG
GSKKKNGK*

SD13256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG30094-PA 161 CG30094-PA 4..161 1..158 847 100 Plus